Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi2g1v0262700 |
Transcript ID | LotjaGi2g1v0262700.2 |
Related isoforms 2 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Chorismate mutase; TAIR: AT3G29200.1 chorismate mutase 1; Swiss-Prot: sp|P42738|CM1_ARATH Chorismate mutase 1, chloroplastic; TrEMBL-Plants: tr|A0A1J7HI29|A0A1J7HI29_LUPAN Uncharacterized protein; Found in the gene: LotjaGi2g1v0262700 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr2:73150302..73150550) extracted from Lotus japonicus Gifu genome v1.2.
ATGACTTTGCAGGACAAGGATAAGTTGATGGACCTGTTAACATATCCTGAAGTTGAAGAGGCAATTAAAAGGAGAGTAGA GATGAAGGCAAAGACTTATGGGCAAGAAGTGGTTGTAAATATGAAGGAACATCGTACTGAGCCAGTGTACAAAATTAATC CAAGCTTGGTTGCTGATCTATATAGTGATTGGATTATGCCATTGACAAAGGAAGTTCAAGTTGCATATTTATTAAGGAAG CTGGACTGA
CDS sequence (LotjaGi2g1v0262700.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGACTTTGCAGGACAAGGATAAGTTGATGGACCTGTTAACATATCCTGAAGTTGAAGAGGCAATTAAAAGGAGAGTAGA GATGAAGGCAAAGACTTATGGGCAAGAAGTGGTTGTAAATATGAAGGAACATCGTACTGAGCCAGTGTACAAAATTAATC CAAGCTTGGTTGCTGATCTATATAGTGATTGGATTATGCCATTGACAAAGGAAGTTCAAGTTGCATATTTATTAAGGAAG CTGGACTGA
Protein sequence (LotjaGi2g1v0262700.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MTLQDKDKLMDLLTYPEVEEAIKRRVEMKAKTYGQEVVVNMKEHRTEPVYKINPSLVADLYSDWIMPLTKEVQVAYLLRK LD
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
ProSiteProfiles | 1 | 82 | 82 | 27.004 | ||
Gene3D | 1 | 82 | 82 | 1.8E-27 | ||
PANTHER | 3 | 82 | 80 | 4.7E-36 | – | |
PANTHER | 3 | 82 | 80 | 4.7E-36 | ||
SUPERFAMILY | 4 | 82 | 79 | 1.28E-23 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | Chorismate mutase activity | Catalysis of the reaction: chorismate = prephenate. | ||
Biological process | Aromatic amino acid family biosynthetic process | The chemical reactions and pathways resulting in the formation of aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan). | ||
Biological process | Chorismate metabolic process | The chemical reactions and pathways involving chorismate, the anion of (3R-trans)-3-((1-carboxyethenyl)oxy)-4-hydroxy-1,5-cyclohexadiene-1-carboxylic acid. |
Expression pattern of LotjaGi2g1v0262700.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…