Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi2g1v0331800.7

Overview

Field	Value
Gene ID	LotjaGi2g1v0331800
Transcript ID	LotjaGi2g1v0331800.7
Related isoforms 6	LotjaGi2g1v0331800.1 LotjaGi2g1v0331800.2 LotjaGi2g1v0331800.3 LotjaGi2g1v0331800.4 LotjaGi2g1v0331800.5 LotjaGi2g1v0331800.6
Lotus japonicus genome version	Gifu v1.2
Description	Phosphoenolpyruvate carboxykinase (ATP); TAIR: AT4G37870.1 phosphoenolpyruvate carboxykinase 1; Swiss-Prot: sp\|Q9T074\|PCKA_ARATH Phosphoenolpyruvate carboxykinase (ATP); TrEMBL-Plants: tr\|A0A0L9UYD4\|A0A0L9UYD4_PHAAN Uncharacterized protein; Found in the gene: LotjaGi2g1v0331800
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr2:80771533..80772123) extracted from Lotus japonicus Gifu genome v1.2.

GTGGCTGGCACAGAGGATGGTATAAAGGAGCCACAGGCAACATTTTCAGCTTGTTTTGGTGCAGCATTTATAATGCTACA CCCTACAAAGTATGCTGCAATGCTTGCTGAAAAGATGGAGCAACATGGTGCTACTGGGTGGCTGGTTAACACTGGTTGGT CTGGTGGCAGGTATAGTTTTAGTTGCTGTCATGTTTCACCCTATTACTATTTCACCCTACAAAACTTATGATTTTAAAGC TAAAATCAATTCTGGAGTGAAGTAGTTTCTGATCACTGGAATTGATTCTGGAAAATGAGAAGTTGTTCCAAAGATGCTAT TAAACTAACTTTGTTCTTTCCTGTGTCTAACTGCAGCTATGGTAGCGGGAGCCGTATCAAACTACAATATACAAGAAAAA TTATTGATGCCATTCACTCTGGAAGCCTCCTGAAGGCAGAGTTCCAGAAAACACCGATATTTGGACTTGAGATTCCGACT GAAGTGGAAGGAGTTCCTTCAGAAATTCTTGATCCTGTGAATACGGTTAGTATAAAATACTAGAGTTCTTAACCTTTTGT AGTTTTTCTATCCTTTGACAAGGTGTTTTAA

Download Genomic Sequence

CDS sequence (LotjaGi2g1v0331800.7) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGCTACACCCTACAAAGTATGCTGCAATGCTTGCTGAAAAGATGGAGCAACATGGTGCTACTGGGTGGCTGGTTAACAC TGGTTGGTCTGGTGGCAGCTATGGTAGCGGGAGCCGTATCAAACTACAATATACAAGAAAAATTATTGATGCCATTCACT CTGGAAGCCTCCTGAAGGCAGAGTTCCAGAAAACACCGATATTTGGACTTGAGATTCCGACTGAAGTGGAAGGAGTTCCT TCAGAAATTCTTGATCCTGTGTTTTAA

Download CDS Sequence

Protein sequence (LotjaGi2g1v0331800.7) extracted from Lotus japonicus Gifu v1.2 Proteins.

MLHPTKYAAMLAEKMEQHGATGWLVNTGWSGGSYGSGSRIKLQYTRKIIDAIHSGSLLKAEFQKTPIFGLEIPTEVEGVP SEILDPVF

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR30031:SF8 View details on PTHR30031:SF8 Search for proteins/transripts with this domain View external data on PTHR30031:SF8	1	87	87	4.0E-51	–
PANTHER	PTHR30031 View details on PTHR30031 Search for proteins/transripts with this domain View external data on PTHR30031	1	87	87	4.0E-51	IPR001272 Show description in modal box View details on IPR001272 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF01293 View details on PF01293 Search for proteins/transripts with this domain View external data on PF01293	1	82	82	5.6E-32	IPR001272 Show description in modal box View details on IPR001272 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:3.90.228.20 View details on G3DSA:3.90.228.20 Search for proteins/transripts with this domain View external data on G3DSA:3.90.228.20	1	87	87	1.3E-37	IPR013035 Show description in modal box View details on IPR013035 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF53795 View details on SSF53795 Search for proteins/transripts with this domain View external data on SSF53795	2	86	85	1.17E-27	–

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0004611 View details of GO:0004611 AmiGO InterPro QuickGO	Molecular function	Phosphoenolpyruvate carboxykinase activity	Catalysis of the reaction: source of phosphate + oxaloacetate = phosphoenolpyruvate + CO2 + other reaction products.	Subterm of View details of GO:0016831
GO:0004612 View details of GO:0004612 AmiGO InterPro QuickGO	Molecular function	Phosphoenolpyruvate carboxykinase (ATP) activity	Catalysis of the reaction: ATP + oxaloacetate = ADP + CO(2) + H(+) + phosphoenolpyruvate.	Subterm of View details of GO:0004611
GO:0005524 View details of GO:0005524 AmiGO InterPro QuickGO	Molecular function	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.	Subterm of View details of GO:0008144 View details of GO:0032559 View details of GO:0035639
GO:0006094 View details of GO:0006094 AmiGO InterPro QuickGO	Biological process	Gluconeogenesis	The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.	Subterm of View details of GO:0006006 View details of GO:0019319
GO:0017076 View details of GO:0017076 AmiGO InterPro QuickGO	Molecular function	Purine nucleotide binding	Interacting selectively and non-covalently with purine nucleotides, any compound consisting of a purine nucleoside esterified with (ortho)phosphate.	Subterm of View details of GO:0000166

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi2g1v0331800.7, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…