Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0018300.2

Overview

Field	Value
Gene ID	LotjaGi3g1v0018300
Transcript ID	LotjaGi3g1v0018300.2
Related isoforms 2	LotjaGi3g1v0018300.1 LotjaGi3g1v0018300.3
Lotus japonicus genome version	Gifu v1.2
Description	Homeobox leucine zipper protein; TAIR: AT1G79840.1 HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain-containing protein; Swiss-Prot: sp\|P46607\|HGL2_ARATH Homeobox-leucine zipper protein GLABRA 2; TrEMBL-Plants: tr\|A0A151QT10\|A0A151QT10_CAJCA Homeobox-leucine zipper protein GLABRA 2; Found in the gene: LotjaGi3g1v0018300
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr3:1915736..1916092) extracted from Lotus japonicus Gifu genome v1.2.

ATGTGGATACTGCAAGATAGCTGCACAAATTCTTATGAGTCAATGGTGGTGTATGCTCCAGTGGACATTACTGGCATGCA GTCTGTGATGACAGGATGTGATTCAAGCAACCTTGCCATACTGCCCTCAGGATTCTCAATTGTTCCTGATGGCCTAGAGT CAAGGCCATTGGTGATTACTACAAGGAAGGAAGAAAAGAACACAGAGGGAGGATCTTTGTTTACAATAGCATTCCAGATC CTTACCAATGCTTCTCCTACAGCAAAGTTAACATTGGAATCTGTGGACTCGGTCAACACTCTTGTATCATGTACATTGAG AAATATCAGAACAAGTTTACAGTGTGAAGATGGATAG

Download Genomic Sequence

CDS sequence (LotjaGi3g1v0018300.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTGGATACTGCAAGATAGCTGCACAAATTCTTATGAGTCAATGGTGGTGTATGCTCCAGTGGACATTACTGGCATGCA GTCTGTGATGACAGGATGTGATTCAAGCAACCTTGCCATACTGCCCTCAGGATTCTCAATTGTTCCTGATGGCCTAGAGT CAAGGCCATTGGTGATTACTACAAGGAAGGAAGAAAAGAACACAGAGGGAGGATCTTTGTTTACAATAGCATTCCAGATC CTTACCAATGCTTCTCCTACAGCAAAGTTAACATTGGAATCTGTGGACTCGGTCAACACTCTTGTATCATGTACATTGAG AAATATCAGAACAAGTTTACAGTGTGAAGATGGATAG

Download CDS Sequence

Protein sequence (LotjaGi3g1v0018300.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MWILQDSCTNSYESMVVYAPVDITGMQSVMTGCDSSNLAILPSGFSIVPDGLESRPLVITTRKEEKNTEGGSLFTIAFQI LTNASPTAKLTLESVDSVNTLVSCTLRNIRTSLQCEDG

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR45654:SF24 View details on PTHR45654:SF24 Search for proteins/transripts with this domain View external data on PTHR45654:SF24	1	116	116	1.5E-47	–
PANTHER	PTHR45654 View details on PTHR45654 Search for proteins/transripts with this domain View external data on PTHR45654	1	116	116	1.5E-47	IPR042160 Show description in modal box View details on IPR042160 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

Unable to find any GO terms for the transcript with the identifier.

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0018300.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…