Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi3g1v0516300 |
Transcript ID | LotjaGi3g1v0516300.2 |
Related isoforms 1 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Auxin-responsive family protein; TAIR: AT4G38840.1 SAUR-like auxin-responsive protein family; Swiss-Prot: sp|P33080|AX10A_SOYBN Auxin-induced protein X10A; TrEMBL-Plants: tr|I1LPV6|I1LPV6_SOYBN Uncharacterized protein; Found in the gene: LotjaGi3g1v0516300 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:93367717..93367992) extracted from Lotus japonicus Gifu genome v1.2.
ATGGGTTTTCGTTTACCAGGTATCAGAAAGGCATCGTCTGTTGTAAACCAAGCATCTTCAAAAGCTGTAGACGTGCCGAA AGGTTATCTTGCCGTTTATGTCGGAGAAAAAATGAAGAGGTTTGTGATCCCCATATCATACTTGAGGGAAACTTCATTCC AAGACTTGCTGATTCAAGCCGAGGAACAATTTGGATATGACCATCCAATGGGCGGTCTCACAATTCCTTGCCGAGAAGAC ATGTTTTTAGATATCACTTCTCACTTAAATAGGTGA
CDS sequence (LotjaGi3g1v0516300.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGGTTTTCGTTTACCAGGTATCAGAAAGGCATCGTCTGTTGTAAACCAAGCATCTTCAAAAGCTGTAGACGTGCCGAA AGGTTATCTTGCCGTTTATGTCGGAGAAAAAATGAAGAGGTTTGTGATCCCCATATCATACTTGAGGGAAACTTCATTCC AAGACTTGCTGATTCAAGCCGAGGAACAATTTGGATATGACCATCCAATGGGCGGTCTCACAATTCCTTGCCGAGAAGAC ATGTTTTTAGATATCACTTCTCACTTAAATAGGTGA
Protein sequence (LotjaGi3g1v0516300.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MGFRLPGIRKASSVVNQASSKAVDVPKGYLAVYVGEKMKRFVIPISYLRETSFQDLLIQAEEQFGYDHPMGGLTIPCRED MFLDITSHLNR
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 1 | 90 | 90 | 3.7E-47 | – | |
PANTHER | 1 | 90 | 90 | 3.7E-47 | – | |
Pfam | 16 | 88 | 73 | 1.1E-23 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Biological process | Response to auxin | Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an auxin stimulus. |
Expression pattern of LotjaGi3g1v0516300.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…