Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0523200.2

Overview

Field Value
Gene ID LotjaGi3g1v0523200
Transcript ID LotjaGi3g1v0523200.2
Related isoforms 1
Lotus japonicus genome version Gifu v1.2
Description Mediator of RNA polymerase II transcription subunit 32; TAIR: AT1G11760.1 mediator of RNA polymerase II transcription subunit-like protein; Swiss-Prot: sp|Q84VW5|MED32_ARATH Mediator of RNA polymerase II transcription subunit 32; TrEMBL-Plants: tr|I1JVU8|I1JVU8_SOYBN Uncharacterized protein; Found in the gene: LotjaGi3g1v0523200
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr3:94038351..94038788) extracted from Lotus japonicus Gifu genome v1.2.

ATGGACAGCGTAGTTGATTCTCTAAATAATGCCTATCAAGATTTTGTTGCTGCAGCCGCAACCGTATTAGAAGCCAAAGA AAATGCCAGTGCCCTTAAAACAACAGCAACAGATACTGCTCTTGAAAACTTCAAACAGAAGTGGGAATTGTTTAGAGTAG CATGTGATCAAGCTGAGGAGTTTGTGGAGTCTGTGAAGCAAAGGATAGGATCAGAGTGTCTGGTTGATGAGGCGACAGGG TATGTGGGCGGAAAACCAGGACAAGCTACCACTGGTCTTCCACCCATCAGTGCAGTTCGCTTGGAACAAATGAGTAAAGC TGTTCGGTGGCTTGTGATTGAATTGCAGCATGGATCTGGATCTGGTTCTGCTAATTCAGCTCTTTCCCATCCCTCAGCTC CTTTTGATGCCAGGTTCTCCGAAGATGCTGCTCAATAG 

CDS sequence (LotjaGi3g1v0523200.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGACAGCGTAGTTGATTCTCTAAATAATGCCTATCAAGATTTTGTTGCTGCAGCCGCAACCGTATTAGAAGCCAAAGA AAATGCCAGTGCCCTTAAAACAACAGCAACAGATACTGCTCTTGAAAACTTCAAACAGAAGTGGGAATTGTTTAGAGTAG CATGTGATCAAGCTGAGGAGTTTGTGGAGTCTGTGAAGCAAAGGATAGGATCAGAGTGTCTGGTTGATGAGGCGACAGGG TATGTGGGCGGAAAACCAGGACAAGCTACCACTGGTCTTCCACCCATCAGTGCAGTTCGCTTGGAACAAATGAGTAAAGC TGTTCGGTGGCTTGTGATTGAATTGCAGCATGGATCTGGATCTGGTTCTGCTAATTCAGCTCTTTCCCATCCCTCAGCTC CTTTTGATGCCAGGTTCTCCGAAGATGCTGCTCAATAG 

Protein sequence (LotjaGi3g1v0523200.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MDSVVDSLNNAYQDFVAAAATVLEAKENASALKTTATDTALENFKQKWELFRVACDQAEEFVESVKQRIGSECLVDEATG YVGGKPGQATTGLPPISAVRLEQMSKAVRWLVIELQHGSGSGSANSALSHPSAPFDARFSEDAAQ 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 1 145 145 2.9E-76
PANTHER 1 145 145 2.9E-76
MobiDBLite 121 145 25 -

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Biological process Regulation of transcription, DNA-templated Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
Biological process Cold acclimation Any process that increases freezing tolerance of an organism in response to low, nonfreezing temperatures.
Biological process Leaf senescence The process that occurs in a leaf near the end of its active life that is associated with the dismantling of cell components and membranes, loss of functional chloroplasts, and an overall decline in metabolism.
Cellular component Mediator complex A protein complex that interacts with the carboxy-terminal domain of the largest subunit of RNA polymerase II and plays an active role in transducing the signal from a transcription factor to the transcriptional machinery. The mediator complex is required for activation of transcription of most protein-coding genes, but can also act as a transcriptional corepressor. The Saccharomyces complex contains several identifiable subcomplexes: a head domain comprising Srb2, -4, and -5, Med6, -8, and -11, and Rox3 proteins; a middle domain comprising Med1, -4, and -7, Nut1 and -2, Cse2, Rgr1, Soh1, and Srb7 proteins; a tail consisting of Gal11p, Med2p, Pgd1p, and Sin4p; and a regulatory subcomplex comprising Ssn2, -3, and -8, and Srb8 proteins. Metazoan mediator complexes have similar modular structures and include homologs of yeast Srb and Med proteins.
Biological process Root development The process whose specific outcome is the progression of the root over time, from its formation to the mature structure. The root is the water- and mineral-absorbing part of a plant which is usually underground, does not bear leaves, tends to grow downwards and is typically derived from the radicle of the embryo.

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0523200.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…