Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi1g1v0756900 |
Transcript ID | LotjaGi1g1v0756900.3 |
Related isoforms 2 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Hexosyltransferase; TAIR: AT2G47180.1 galactinol synthase 1; Swiss-Prot: sp|C7G304|GOLS2_SOLLC Galactinol synthase 2; TrEMBL-Plants: tr|A0A1D6YD62|A0A1D6YD62_CICAR Hexosyltransferase; Found in the gene: LotjaGi1g1v0756900 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr1:133028463..133028841) extracted from Lotus japonicus Gifu genome v1.2.
ATGGCTCCTGAGCTAGTTCCAACTGCAACGAAATCTGTTACCGGTTTCAACAGACCGGTGACTCTGCAGAAACGTGCATA CGTGACGTTTCTTGCCGGAAACGGTGACTACGTGAAAGGCGTGGTTGGGCTCGCCAAAGGGTTGCGGAAGGTGAAGAGTG CGTACCCGTTGGTGGTTGCCGTGCTCCCTGACGTGCCGGAGGAGCACCGTGAGATCCTGGAGTCTCAGGGCTGTATTGTC CGGGAGATTGAACCCGTTTACCCGCCGGAAAACCAGACCCAATTTGCCATGGCGTATTACGTCATCAACTATTCCAAGCT CCGTATCTGGGAGGTACGTTCCGTGCATTGATTCATACACGTAACACGTAGACTCTTGA
CDS sequence (LotjaGi1g1v0756900.3) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGCTCCTGAGCTAGTTCCAACTGCAACGAAATCTGTTACCGGTTTCAACAGACCGGTGACTCTGCAGAAACGTGCATA CGTGACGTTTCTTGCCGGAAACGGTGACTACGTGAAAGGCGTGGTTGGGCTCGCCAAAGGGTTGCGGAAGGTGAAGAGTG CGTACCCGTTGGTGGTTGCCGTGCTCCCTGACGTGCCGGAGGAGCACCGTGAGATCCTGGAGTCTCAGGGCTGTATTGTC CGGGAGATTGAACCCGTTTACCCGCCGGAAAACCAGACCCAATTTGCCATGGCGTATTACGTCATCAACTATTCCAAGCT CCGTATCTGGGAGGTACGTTCCGTGCATTGA
Protein sequence (LotjaGi1g1v0756900.3) extracted from Lotus japonicus Gifu v1.2 Proteins.
MAPELVPTATKSVTGFNRPVTLQKRAYVTFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPEEHREILESQGCIV REIEPVYPPENQTQFAMAYYVINYSKLRIWEVRSVH
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 1 | 112 | 112 | 1.7E-64 | – | |
PANTHER | 1 | 112 | 112 | 1.7E-64 | ||
Gene3D | 21 | 116 | 96 | 8.4E-16 | ||
SUPERFAMILY | 24 | 112 | 89 | 7.59E-13 | ||
Pfam | 29 | 112 | 84 | 6.2E-7 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Biological process | Galactose metabolic process | The chemical reactions and pathways involving galactose, the aldohexose galacto-hexose. D-galactose is widely distributed in combined form in plants, animals and microorganisms as a constituent of oligo- and polysaccharides; it also occurs in galactolipids and as its glucoside in lactose and melibiose. | ||
Molecular function | Transferase activity, transferring glycosyl groups | Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor). | ||
Molecular function | Inositol 3-alpha-galactosyltransferase activity | Catalysis of the reaction: myo-inositol + UDP-galactose = O-alpha-D-galactosyl-(1,3)-1D-myo-inositol + UDP. |
Expression pattern of LotjaGi1g1v0756900.3, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…