Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi2g1v0337300 |
Transcript ID | LotjaGi2g1v0337300.2 |
Related isoforms 2 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Xyloglucan endotransglucosylase/hydrolase; TAIR: AT1G32170.1 xyloglucan endotransglucosylase/hydrolase 30; Swiss-Prot: sp|Q38908|XTH30_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 30; TrEMBL-Plants: tr|I3SK34|I3SK34_LOTJA Xyloglucan endotransglucosylase/hydrolase; Found in the gene: LotjaGi2g1v0337300 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr2:81431257..81431733) extracted from Lotus japonicus Gifu genome v1.2.
ATGGGAGCTGATTACCCAGCAAAGCCAATGGCATTATACGCCACAATATGGGATGCATCAAATTGGGCCACATCGGGTGG AAAATACAAAGTGAACTACAAATATGCACCATTTGTGACCGAGATGAAGGACCTAGTCCTCAAGGGTTGCTCCGTTGACC CCATCCAAGAAGTTTCCGCCAGGGAGCTATGCTCCGATCAGCACGCTGACCTCGAGGAGCAAGACTACGCAGCTGTGACG CCTCTTCGCCGCCTCGCTATGCGGAGGTTTCGCCAGCGTTATATGTACTACTCTTATTGCTATGATACGTTGAGGTACTC TGTGCCGCCACCCGAGTGTGTTATTATTCCCGCGGAGAAACAAAGATTTAAGGAGACTGGGAGGTTGAGATTCGGTGGCA GCCACCGTCGACACTCTAGGGCACGGCGTAGCCGTACTTCAACTCCAGTAGATGAGTCTGATCAGGGTGATATGTGA
CDS sequence (LotjaGi2g1v0337300.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGGAGCTGATTACCCAGCAAAGCCAATGGCATTATACGCCACAATATGGGATGCATCAAATTGGGCCACATCGGGTGG AAAATACAAAGTGAACTACAAATATGCACCATTTGTGACCGAGATGAAGGACCTAGTCCTCAAGGGTTGCTCCGTTGACC CCATCCAAGAAGTTTCCGCCAGGGAGCTATGCTCCGATCAGCACGCTGACCTCGAGGAGCAAGACTACGCAGCTGTGACG CCTCTTCGCCGCCTCGCTATGCGGAGGTTTCGCCAGCGTTATATGTACTACTCTTATTGCTATGATACGTTGAGGTACTC TGTGCCGCCACCCGAGTGTGTTATTATTCCCGCGGAGAAACAAAGATTTAAGGAGACTGGGAGGTTGAGATTCGGTGGCA GCCACCGTCGACACTCTAGGGCACGGCGTAGCCGTACTTCAACTCCAGTAGATGAGTCTGATCAGGGTGATATGTGA
Protein sequence (LotjaGi2g1v0337300.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MGADYPAKPMALYATIWDASNWATSGGKYKVNYKYAPFVTEMKDLVLKGCSVDPIQEVSARELCSDQHADLEEQDYAAVT PLRRLAMRRFRQRYMYYSYCYDTLRYSVPPPECVIIPAEKQRFKETGRLRFGGSHRRHSRARRSRTSTPVDESDQGDM
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
Gene3D | 1 | 113 | 113 | 2.3E-29 | – | |
PANTHER | 1 | 130 | 130 | 5.6E-55 | – | |
PANTHER | 1 | 130 | 130 | 5.6E-55 | – | |
SUPERFAMILY | 2 | 115 | 114 | 1.76E-19 | ||
Pfam | 4 | 34 | 31 | 1.9E-5 | ||
Pfam | 78 | 113 | 36 | 2.5E-13 | ||
MobiDBLite | 127 | 158 | 32 | - | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | Hydrolase activity, hydrolyzing O-glycosyl compounds | Catalysis of the hydrolysis of any O-glycosyl bond. | ||
Cellular component | Cell wall | The rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal, most prokaryotic cells and some protozoan parasites, maintaining their shape and protecting them from osmotic lysis. In plants it is made of cellulose and, often, lignin; in fungi it is composed largely of polysaccharides; in bacteria it is composed of peptidoglycan; in protozoan parasites such as Giardia species, it's made of carbohydrates and proteins. | ||
Biological process | Carbohydrate metabolic process | The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule. | ||
Biological process | Cellular glucan metabolic process | The chemical reactions and pathways involving glucans, polysaccharides consisting only of glucose residues, occurring at the level of an individual cell. | ||
Molecular function | Xyloglucan:xyloglucosyl transferase activity | Catalysis of the cleavage of a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan. | ||
Cellular component | Apoplast | The cell membranes and intracellular regions in a plant are connected through plasmodesmata, and plants may be described as having two major compartments: the living symplast and the non-living apoplast. The apoplast is external to the plasma membrane and includes cell walls, intercellular spaces and the lumen of dead structures such as xylem vessels. Water and solutes pass freely through it. |
Expression pattern of LotjaGi2g1v0337300.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…