Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0026400.1

Overview

Field	Value
Gene ID	LotjaGi3g1v0026400
Transcript ID	LotjaGi3g1v0026400.1
Related isoforms 1	LotjaGi3g1v0026400.2
Lotus japonicus genome version	Gifu v1.2
Description	Zinc finger family protein; TAIR: AT2G02080.1 indeterminate(ID)-domain 4; Swiss-Prot: sp\|Q8GYC1\|IDD4_ARATH Protein indeterminate-domain 4, chloroplastic; TrEMBL-Plants: tr\|A9T4T1\|A9T4T1_PHYPA Predicted protein; Found in the gene: LotjaGi3g1v0026400
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr3:2886343..2886875) extracted from Lotus japonicus Gifu genome v1.2.

TTAGACCCAGAAGCTGAAGTTGTGGCCATGTCTCCAAAGTCTCTTATGGCAACAAACAGGTTCTTATGTGAGATCTGCAA CAAAGGATTCCAAAGAGATCAGAATCTTCAGCTTCATAGAAGAGGGCACAATTTACCATGGAAGTTGAAGCAGAGAACTA GCAAGGAGATTAGGAGGAAAGTTTATGTGTGTCCAGAACCAACATGTGTTCACCATGACCCATCAAGAGCCTTAGGGGAC TTAACAGGCATCAAGAAGCACTTTTCCAGAAAGCATGGTGAGAAGAAGTGGAAATGTGAAAAGTGCTCCAAGAAGTATGC AGTTCAATCAGACTGGAAAGCTCACTCCAAAACCTGTGGTACAAGAGAATACAGATGTGACTGTGGAACCCTCTTCTCAA GGTAAAAAAGAAAAAAACCTTAAACCATTATGAACCATGATTCATGACATGTGAATTTTGCAGGTGATTTAATTTAGTTC ATTCAAGTCAGAGACATCATTCATTTATTGATTTGAATCCGAGGTTGACATAA

Download Genomic Sequence

CDS sequence (LotjaGi3g1v0026400.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTCTCCAAAGTCTCTTATGGCAACAAACAGGTTCTTATGTGAGATCTGCAACAAAGGATTCCAAAGAGATCAGAATCT TCAGCTTCATAGAAGAGGGCACAATTTACCATGGAAGTTGAAGCAGAGAACTAGCAAGGAGATTAGGAGGAAAGTTTATG TGTGTCCAGAACCAACATGTGTTCACCATGACCCATCAAGAGCCTTAGGGGACTTAACAGGCATCAAGAAGCACTTTTCC AGAAAGCATGGTGAGAAGAAGTGGAAATGTGAAAAGTGCTCCAAGAAGTATGCAGTTCAATCAGACTGGAAAGCTCACTC CAAAACCTGTGGTACAAGAGAATACAGATGTGACTGTGGAACCCTCTTCTCAAGTTCATTCAAGTCAGAGACATCATTCA TTTATTGA

Download CDS Sequence

Protein sequence (LotjaGi3g1v0026400.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTSKEIRRKVYVCPEPTCVHHDPSRALGDLTGIKKHFS RKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYRCDCGTLFSSSFKSETSFIY

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR10593:SF120 View details on PTHR10593:SF120 Search for proteins/transripts with this domain View external data on PTHR10593:SF120	1	125	125	2.0E-109	–
PANTHER	PTHR10593 View details on PTHR10593 Search for proteins/transripts with this domain View external data on PTHR10593	1	125	125	2.0E-109	–
Gene3D	G3DSA:3.30.160.60 View details on G3DSA:3.30.160.60 Search for proteins/transripts with this domain View external data on G3DSA:3.30.160.60	8	35	28	5.4E-6	–
SUPERFAMILY	SSF57667 View details on SSF57667 Search for proteins/transripts with this domain View external data on SSF57667	11	108	98	5.66E-8	IPR036236 Show description in modal box View details on IPR036236 Search for proteins/transripts with this domain View on EBI InterPro Service
SMART	SM00355 View details on SM00355 Search for proteins/transripts with this domain View external data on SM00355	12	34	23	0.11	IPR013087 Show description in modal box View details on IPR013087 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS50157 View details on PS50157 Search for proteins/transripts with this domain View external data on PS50157	12	34	23	10.824	IPR013087 Show description in modal box View details on IPR013087 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSitePatterns	PS00028 View details on PS00028 Search for proteins/transripts with this domain View external data on PS00028	14	34	21	-	IPR013087 Show description in modal box View details on IPR013087 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:3.30.160.60 View details on G3DSA:3.30.160.60 Search for proteins/transripts with this domain View external data on G3DSA:3.30.160.60	46	133	88	7.0E-6	–
SMART	SM00355 View details on SM00355 Search for proteins/transripts with this domain View external data on SM00355	53	83	31	82.0	IPR013087 Show description in modal box View details on IPR013087 Search for proteins/transripts with this domain View on EBI InterPro Service
SMART	SM00355 View details on SM00355 Search for proteins/transripts with this domain View external data on SM00355	88	108	21	140.0	IPR013087 Show description in modal box View details on IPR013087 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0003676 View details of GO:0003676 AmiGO InterPro QuickGO	Molecular function	Nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.	Subterm of View details of GO:0097159 View details of GO:1901363

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0026400.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…