Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi3g1v0553000 |
| Transcript ID | LotjaGi3g1v0553000.6 |
| Related isoforms 5 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | COP9 signalosome complex subunit 4; TAIR: AT5G42970.1 Proteasome component (PCI) domain protein; Swiss-Prot: sp|Q8L5U0|CSN4_ARATH COP9 signalosome complex subunit 4; TrEMBL-Plants: tr|I3RZF8|I3RZF8_LOTJA Uncharacterized protein; Found in the gene: LotjaGi3g1v0553000 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:97047775..97048245) extracted from Lotus japonicus Gifu genome v1.2.
GTTTTGTTGATGAATTGTTTGATGTGATACAGTGATGGAGAGCGCTTTTGCGAGCGCTTCTGCGATTACAGACCAGAGGC AAAAGATTGAGCAATACAAACAAATCCTCTCCGCTGTAATTTCATCCAATGATATTGCTCAGGCTCGGAGATTCATTGAT CACAGTTAAACTCCCTTTTTCTCTATCTAGGGTTTTCTAGTTTGTTCTTGCTTTTACATTCAAACATAAATGTGATTTCA ATTATCGAGAACTACCCGTCGAGACGGAAGAATGTCAATATTAGGTTCTTAAAACTATGTGTCGTCTTTTCAGTGTTATC AGATGATGTTCCGTTAGTAGTGTCACGGCAGCTTCTGCAGACTTTTGCTGAAGAATTGGGAAGATTAGGGGCTGGGACGC AGAAAGAGATTGCGCATTACACCCTTACTCAGATTCAGCCTCGTGTTGTGTCATTCGAAGAGCAGGTTTGA
CDS sequence (LotjaGi3g1v0553000.6) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGAGAGCGCTTTTGCGAGCGCTTCTGCGATTACAGACCAGAGGCAAAAGATTGAGCAATACAAACAAATCCTCTCCGC TGTAATTTCATCCAATGATATTGCTCAGGCTCGGAGATTCATTGATCACATGTTATCAGATGATGTTCCGTTAGTAGTGT CACGGCAGCTTCTGCAGACTTTTGCTGAAGAATTGGGAAGATTAGGGGCTGGGACGCAGAAAGAGATTGCGCATTACACC CTTACTCAGATTCAGCCTCGTGTTGTGTCATTCGAAGAGCAGGTTTGA
Protein sequence (LotjaGi3g1v0553000.6) extracted from Lotus japonicus Gifu v1.2 Proteins.
MESAFASASAITDQRQKIEQYKQILSAVISSNDIAQARRFIDHMLSDDVPLVVSRQLLQTFAEELGRLGAGTQKEIAHYT LTQIQPRVVSFEEQV
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| PANTHER | 1 | 95 | 95 | 1.7E-28 | ||
| PANTHER | 1 | 95 | 95 | 1.7E-28 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Cellular component | COP9 signalosome | A protein complex that catalyzes the deneddylation of proteins, including the cullin component of SCF ubiquitin E3 ligase; deneddylation increases the activity of cullin family ubiquitin ligases. The signalosome is involved in many regulatory process, including some which control development, in many species; also regulates photomorphogenesis in plants; in many species its subunits are highly similar to those of the proteasome. |
Expression pattern of LotjaGi3g1v0553000.6, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…