Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi5g1v0327900 |
| Transcript ID | LotjaGi5g1v0327900.2 |
| Related isoforms 5 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Cyclin-T1; TAIR: AT1G71130.1 Integrase-type DNA-binding superfamily protein; Swiss-Prot: sp|Q9QWV9|CCNT1_MOUSE Cyclin-T1; TrEMBL-Plants: tr|A0A0A9F0C1|A0A0A9F0C1_ARUDO Si707066f01; Found in the gene: LotjaGi5g1v0327900 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr5:64508028..64508282) extracted from Lotus japonicus Gifu genome v1.2.
ATGGCGGCGAGGAGGGCAATACCGTGCTCAGCGGCAGCAACAGTGTTGGCGGTGGGGGCATTGACAACCAAACATCCATG CTCAGTGGCGGCGGCGAGATCCACGTTGTCGATTCCGACGCCAGCTCTTCCAACGACCTTGAGCCTACCAGCGGAGGATT CAAACACCTCGCGATTGACCTTGGTGCCACTGCGGACGATTAAGGCGTCGCAGAGGGAGATCTTGGTGCAGAGCTCCTCA GGGGTGAGATTGTAG
CDS sequence (LotjaGi5g1v0327900.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGCGGCGAGGAGGGCAATACCGTGCTCAGCGGCAGCAACAGTGTTGGCGGTGGGGGCATTGACAACCAAACATCCATG CTCAGTGGCGGCGGCGAGATCCACGTTGTCGATTCCGACGCCAGCTCTTCCAACGACCTTGAGCCTACCAGCGGAGGATT CAAACACCTCGCGATTGACCTTGGTGCCACTGCGGACGATTAAGGCGTCGCAGAGGGAGATCTTGGTGCAGAGCTCCTCA GGGGTGAGATTGTAG
Protein sequence (LotjaGi5g1v0327900.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MAARRAIPCSAAATVLAVGALTTKHPCSVAAARSTLSIPTPALPTTLSLPAEDSNTSRLTLVPLRTIKASQREILVQSSS GVRL
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| SignalP_GRAM_POSITIVE | 1 | 31 | 31 | - | – | |
| Phobius | 1 | 5 | 5 | - | – | |
| SignalP_EUK | 1 | 17 | 17 | - | – | |
| Phobius | 1 | 20 | 20 | - | – | |
| Phobius | 6 | 16 | 11 | - | – | |
| Phobius | 17 | 20 | 4 | - | – | |
| Phobius | 21 | 84 | 64 | - | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
Expression pattern of LotjaGi5g1v0327900.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…