Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi1g1v0051400.2

Overview

Field Value
Gene ID LotjaGi1g1v0051400
Transcript ID LotjaGi1g1v0051400.2
Related isoforms 1
Lotus japonicus genome version Gifu v1.2
Description RNA binding protein; TAIR: AT5G12190.1 RNA-binding (RRM/RBD/RNP motifs) family protein; Swiss-Prot: sp|Q9FMP4|SF3B6_ARATH Splicing factor 3B subunit 6-like protein; TrEMBL-Plants: tr|I3SB95|I3SB95_LOTJA Uncharacterized protein; Found in the gene: LotjaGi1g1v0051400
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr1:7285676..7286053) extracted from Lotus japonicus Gifu genome v1.2.

ATGGCGACAATCAGCCTCCGGAAGGGAAACACACGGTTGCCACCGGAAGTCAACCGCGTCCTCTACGTCCGAAACCTCCC ATTCAACATCACAAGCGAGGAGATGTACGATATCTTCGGCAAGTACGGCGCAATCCGCCAGATCCGAATCGGAACCACCA AGGACACGCGCGGCACCGCCTTCGTCGTGTATGAGGACATCTACGACGCCAAAACCGCCGTCGATCACCTCTCCGGCTTC AACGTCGCCAACCGCTACCTCATCGTGTTGTATTACCAGCAGGCGAAGATGAGCAAGAAGTTTGACCAGAAGAAGAAGGA GGATGAGATCGCGAGGATGCAGGAGAAGTATGGCGTTTCCACCAAAGACGTCAAGTAG 

CDS sequence (LotjaGi1g1v0051400.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCGACAATCAGCCTCCGGAAGGGAAACACACGGTTGCCACCGGAAGTCAACCGCGTCCTCTACGTCCGAAACCTCCC ATTCAACATCACAAGCGAGGAGATGTACGATATCTTCGGCAAGTACGGCGCAATCCGCCAGATCCGAATCGGAACCACCA AGGACACGCGCGGCACCGCCTTCGTCGTGTATGAGGACATCTACGACGCCAAAACCGCCGTCGATCACCTCTCCGGCTTC AACGTCGCCAACCGCTACCTCATCGTGTTGTATTACCAGCAGGCGAAGATGAGCAAGAAGTTTGACCAGAAGAAGAAGGA GGATGAGATCGCGAGGATGCAGGAGAAGTATGGCGTTTCCACCAAAGACGTCAAGTAG 

Protein sequence (LotjaGi1g1v0051400.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MATISLRKGNTRLPPEVNRVLYVRNLPFNITSEEMYDIFGKYGAIRQIRIGTTKDTRGTAFVVYEDIYDAKTAVDHLSGF NVANRYLIVLYYQQAKMSKKFDQKKKEDEIARMQEKYGVSTKDVK 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 6 123 118 2.7E-57
PANTHER 6 123 118 2.7E-57
SUPERFAMILY 7 102 96 4.84E-24
Gene3D 15 120 106 1.1E-23
CDD 17 93 77 1.0948E-53
ProSiteProfiles 19 94 76 16.551
SMART 20 90 71 9.8E-18
Pfam 21 87 67 4.2E-18

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Molecular function Nucleic acid binding Interacting selectively and non-covalently with any nucleic acid.

Expression data

Expression pattern

Expression pattern of LotjaGi1g1v0051400.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…