Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi1g1v0246300 |
| Transcript ID | LotjaGi1g1v0246300.7 |
| Related isoforms 6 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Acetyl-CoA carboxylase; TAIR: AT1G36160.1 acetyl-CoA carboxylase 1; Swiss-Prot: sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1; TrEMBL-Plants: tr|A0A0B2SKF5|A0A0B2SKF5_GLYSO Acetyl-CoA carboxylase 1; Found in the gene: LotjaGi1g1v0246300 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr1:59100825..59101656) extracted from Lotus japonicus Gifu genome v1.2.
ATGAAGATGTGCATGCCTCTTCTTTCACCTGCTTCTGGGAAAATTCATTTCAAAATGTCTGAAGGTCAAGCAATGCAGGT ATATCTACATAGGGAGTACAAGTGCTTGTCATGAACCAAACTATCGAAAAAATAAGCTATTGGGTAAAGAAACATGAATG ATTTATATTATATTTCTAACCATCATCTCACGTAAGAGCCCATTAGGCTTGAAGCGCGAACAATGCACAGTGCCCTGTGC TGAAATTCAACTTCTAATTCAAATAATGGAGCACCAGGATCAAACTCTAGACCACCACTTGGTCACAGAGGCTTTGATAC TATTACCATGTCACTAACCAACTATCCAAAAATATTAAGCTATTGGGTGAAAACACATAAATGGTTTTAAATTATATTTC TAACAGTGCTTAAAATGAAAGAGGATAAGAAAAAATTGTCTTTTGCAGGCTGGTGAACTTATAGCAAGGCTTGATCTAGA TGATCCTTCAGCTGTAAGAAAGGCGGAACCCTTCACTGGGAACTTCCCAGTCTTGGGTTTTCCTACTGCAATTTCAGGTA AAGTTCATCAGAAATGTGCCGCAAGCTTAAATGCTGCACGGATGATTCTTGCTGGCTATGAGCACAATATTGATGAGGTG TGTACATTCTTCACCTTGATTCATTAAAAATGCAACTTGATAGTAGTTTTAGGTGGTTATGGTTCAGCCGTCATGGATAG GAGATTTTTGGATCCTAGTATTATTTCGAGACTTGTATCTTCTTGTCTTATTAAAAGCTAGATATCTGTCTCAGGTTGTG CAAAGTTTGCTCAATTGCCTTGACAGTCCTGA
CDS sequence (LotjaGi1g1v0246300.7) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGAAGATGTGCATGCCTCTTCTTTCACCTGCTTCTGGGAAAATTCATTTCAAAATGTCTGAAGGTCAAGCAATGCAGGC TGGTGAACTTATAGCAAGGCTTGATCTAGATGATCCTTCAGCTGTAAGAAAGGCGGAACCCTTCACTGGGAACTTCCCAG TCTTGGGTTTTCCTACTGCAATTTCAGGTAAAGTTCATCAGAAATGTGCCGCAAGCTTAAATGCTGCACGGATGATTCTT GCTGGCTATGAGCACAATATTGATGAGGTCTAG
Protein sequence (LotjaGi1g1v0246300.7) extracted from Lotus japonicus Gifu v1.2 Proteins.
MKMCMPLLSPASGKIHFKMSEGQAMQAGELIARLDLDDPSAVRKAEPFTGNFPVLGFPTAISGKVHQKCAASLNAARMIL AGYEHNIDEV
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| Gene3D | 1 | 36 | 36 | 1.9E-9 | – | |
| PANTHER | 1 | 90 | 90 | 4.0E-42 | – | |
| PANTHER | 1 | 90 | 90 | 4.0E-42 | – | |
| Pfam | 35 | 89 | 55 | 6.4E-15 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | Acetyl-CoA carboxylase activity | Catalysis of the reaction: ATP + acetyl-CoA + HCO3- = ADP + phosphate + malonyl-CoA. | ||
| Molecular function | ATP binding | Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator. | ||
| Biological process | Fatty acid biosynthetic process | The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes. |
Expression pattern of LotjaGi1g1v0246300.7, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…