Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi2g1v0206400.2

Overview

Field Value
Gene ID LotjaGi2g1v0206400
Transcript ID LotjaGi2g1v0206400.2
Related isoforms 4
Lotus japonicus genome version Gifu v1.2
Description alpha/beta-Hydrolases superfamily protein; TAIR: AT5G16120.2 alpha/beta-Hydrolases superfamily protein; Swiss-Prot: sp|Q9C942|CSE_ARATH Caffeoylshikimate esterase; TrEMBL-Plants: tr|I3SCM0|I3SCM0_LOTJA Uncharacterized protein; Found in the gene: LotjaGi2g1v0206400
Working Lj name n.a.

We have encountered a general error: No InterPro domain data available

Sequence information

Genomic sequence (LjG1.1_chr2:64991399..64991605) extracted from Lotus japonicus Gifu genome v1.2.

ATGCATGGAGAGGCAGATATAATAACTGACCCATCAGCTAGCAAGGCTTTGTATGAGAAAGCTAAAGTGAAGGACAAGAA ACTCTGCCTCTATAAGGATGCTTTCCACACTCTGCTTGAAGGTGAGCCTGATGAAACTATATTCCACGTGCTTGGTGATC TCATATCTTGGCTTGACAACCACAGCAGCAGAAAAAACAAATATTAA 

CDS sequence (LotjaGi2g1v0206400.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGCATGGAGAGGCAGATATAATAACTGACCCATCAGCTAGCAAGGCTTTGTATGAGAAAGCTAAAGTGAAGGACAAGAA ACTCTGCCTCTATAAGGATGCTTTCCACACTCTGCTTGAAGGTGAGCCTGATGAAACTATATTCCACGTGCTTGGTGATC TCATATCTTGGCTTGACAACCACAGCAGCAGAAAAAACAAATATTAA 

Protein sequence (LotjaGi2g1v0206400.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MHGEADIITDPSASKALYEKAKVKDKKLCLYKDAFHTLLEGEPDETIFHVLGDLISWLDNHSSRKNKY 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Unable to find any records for the transcript with the identifer LotjaGi2g1v0206400.2.

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

Unable to find any GO terms for the transcript with the identifier.

Expression data

Expression pattern

Expression pattern of LotjaGi2g1v0206400.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…