Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0038000.1

Overview

Field	Value
Gene ID	LotjaGi3g1v0038000
Transcript ID	LotjaGi3g1v0038000.1
Lotus japonicus genome version	Gifu v1.2
Description	MADS-box transcription factor family protein; TAIR: AT2G34440.1 AGAMOUS-like 29; Swiss-Prot: sp\|O64703\|AGL29_ARATH Agamous-like MADS-box protein AGL29; TrEMBL-Plants: tr\|A0A072VIJ3\|A0A072VIJ3_MEDTR MADS-box transcription factor family protein; Found in the gene: LotjaGi3g1v0038000
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr3:4109000..4109798) extracted from Lotus japonicus Gifu genome v1.2.

GAATCTCTTTAGCTATAAATAGGGGTTTGAGGATAACACATACCACCTATGAGTTGATCTGAGTTCATTTTACAATAAAC CCTTCTTTTCTAATCTTTTGATCTTTTGTTATCAGGTGAAGGTACCATGGGTCGAAAGAAGATTAAGATGGAGCTTGTGA AAGACCCCAACACGAGGCAGGTCACATTCTCCAAGCGTCGAACCGGCTTATTCAAGAAAACAAATGAGTTATCCATCATG TGTGGAACAGAAATTGCTGTTGTTGTATTCTCCCCCGGGAACAAGCCTTACTCCTATGGGCACCCAAGTGTGGATGCTGT TGCGGCCAAGTATCTTCAAATAGAGCCCAATTCTGATGATGATGCCCAAGGTGGTAGCACTAGCAACCCCTCTGCTGACG TTTTTGACATGGACCAACAGAATCTAGAACTTGCTGATGTGATGGCCCAGATTCGTGAGGAAGAAAAGAAGGCTAAGGTG CTTGCTGAGACCCTGAAAGAACAGCAAGTGACTATACGCTCTGAGTATCAAGACTTGAATGATTGTTATGGAGAGCTCCA AGGTATGGTGGAAAAGCGTCTCACTGAGTTTGAGATAGCAGAACTTATGGTCCTTCTTTCGGAAGGAAAAGTGGAAGGAA TGACTGTGGAAAACAAAGATGAAAAGAAGAAATAGAGTAAGAATTGATGTTTGTACTACATGATATATGGGAGAGAAAAT AGTCAGTGGTGAATTATGTGTTTTGTAATGTGAAATTTCTGACGTTTAAGAAGAAATAAAATTATTTTGATATTTCATA

Download Genomic Sequence

CDS sequence (LotjaGi3g1v0038000.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGGTCGAAAGAAGATTAAGATGGAGCTTGTGAAAGACCCCAACACGAGGCAGGTCACATTCTCCAAGCGTCGAACCGG CTTATTCAAGAAAACAAATGAGTTATCCATCATGTGTGGAACAGAAATTGCTGTTGTTGTATTCTCCCCCGGGAACAAGC CTTACTCCTATGGGCACCCAAGTGTGGATGCTGTTGCGGCCAAGTATCTTCAAATAGAGCCCAATTCTGATGATGATGCC CAAGGTGGTAGCACTAGCAACCCCTCTGCTGACGTTTTTGACATGGACCAACAGAATCTAGAACTTGCTGATGTGATGGC CCAGATTCGTGAGGAAGAAAAGAAGGCTAAGGTGCTTGCTGAGACCCTGAAAGAACAGCAAGTGACTATACGCTCTGAGT ATCAAGACTTGAATGATTGTTATGGAGAGCTCCAAGGTATGGTGGAAAAGCGTCTCACTGAGTTTGAGATAGCAGAACTT ATGGTCCTTCTTTCGGAAGGAAAAGTGGAAGGAATGACTGTGGAAAACAAAGATGAAAAGAAGAAATAG

Download CDS Sequence

Protein sequence (LotjaGi3g1v0038000.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MGRKKIKMELVKDPNTRQVTFSKRRTGLFKKTNELSIMCGTEIAVVVFSPGNKPYSYGHPSVDAVAAKYLQIEPNSDDDA QGGSTSNPSADVFDMDQQNLELADVMAQIREEEKKAKVLAETLKEQQVTIRSEYQDLNDCYGELQGMVEKRLTEFEIAEL MVLLSEGKVEGMTVENKDEKKK

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
ProSiteProfiles	PS50066 View details on PS50066 Search for proteins/transripts with this domain View external data on PS50066	1	61	61	24.488	IPR002100 Show description in modal box View details on IPR002100 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF55455 View details on SSF55455 Search for proteins/transripts with this domain View external data on SSF55455	1	74	74	2.09E-26	IPR036879 Show description in modal box View details on IPR036879 Search for proteins/transripts with this domain View on EBI InterPro Service
SMART	SM00432 View details on SM00432 Search for proteins/transripts with this domain View external data on SM00432	1	60	60	5.7E-31	IPR002100 Show description in modal box View details on IPR002100 Search for proteins/transripts with this domain View on EBI InterPro Service
PANTHER	PTHR11945 View details on PTHR11945 Search for proteins/transripts with this domain View external data on PTHR11945	2	174	173	8.1E-61	–
PANTHER	PTHR11945:SF229 View details on PTHR11945:SF229 Search for proteins/transripts with this domain View external data on PTHR11945:SF229	2	174	173	8.1E-61	–
PRINTS	PR00404 View details on PR00404 Search for proteins/transripts with this domain View external data on PR00404	3	23	21	1.8E-17	IPR002100 Show description in modal box View details on IPR002100 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF00319 View details on PF00319 Search for proteins/transripts with this domain View external data on PF00319	12	57	46	5.5E-23	IPR002100 Show description in modal box View details on IPR002100 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:3.40.1810.10 View details on G3DSA:3.40.1810.10 Search for proteins/transripts with this domain View external data on G3DSA:3.40.1810.10	13	77	65	9.3E-26	IPR036879 Show description in modal box View details on IPR036879 Search for proteins/transripts with this domain View on EBI InterPro Service
PRINTS	PR00404 View details on PR00404 Search for proteins/transripts with this domain View external data on PR00404	23	38	16	1.8E-17	IPR002100 Show description in modal box View details on IPR002100 Search for proteins/transripts with this domain View on EBI InterPro Service
PRINTS	PR00404 View details on PR00404 Search for proteins/transripts with this domain View external data on PR00404	38	59	22	1.8E-17	IPR002100 Show description in modal box View details on IPR002100 Search for proteins/transripts with this domain View on EBI InterPro Service
Coils	Coil View details on Coil Search for proteins/transripts with this domain	95	129	35	-	–

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0003677 View details of GO:0003677 AmiGO InterPro QuickGO	Molecular function	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).	Subterm of View details of GO:0003676
GO:0046983 View details of GO:0046983 AmiGO InterPro QuickGO	Molecular function	Protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.	Subterm of View details of GO:0005515

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0038000.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…