Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0097700.4

Overview

Field	Value
Gene ID	LotjaGi3g1v0097700
Transcript ID	LotjaGi3g1v0097700.4
Related isoforms 6	LotjaGi3g1v0097700.1 LotjaGi3g1v0097700.2 LotjaGi3g1v0097700.3 LotjaGi3g1v0097700.5 LotjaGi3g1v0097700.6 LotjaGi3g1v0097700.7
Lotus japonicus genome version	Gifu v1.2
Description	NAD(P)H dehydrogenase (Quinone); TAIR: AT4G27270.1 Quinone reductase family protein; Swiss-Prot: sp\|Q6NQE2\|FQRL1_ARATH Probable NAD(P)H dehydrogenase (quinone) FQR1-like 1; TrEMBL-Plants: tr\|I3S201\|I3S201_LOTJA Uncharacterized protein; Found in the gene: LotjaGi3g1v0097700
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr3:12167758..12168429) extracted from Lotus japonicus Gifu genome v1.2.

ATGGGGGCACCACCAAAGAGTGATGTACCAATCATTACCCCTCATGAGCTCTCTGAGGGTGATGGATTTGTGTTTGGCTT CCCAACAAGATTTGGAATGATGGCTGCACAGTTTAAAGCTTTTCTAGATTCAACTGGAGGTCTATGGAAAACACAACAGC TTGCTGGCAAGCCTGCTGGACTCTTCTACAGCACAGGTTCCCAAGGTGGTGGGCAAGAGACAACAGCGTAAGAGTTTCTA CCTGATAGCATGTTCGGAAATCTTTCTACTTTAATTGATTCGAAGTTAGAATCGATTCTGGGGAAAAGCTTCTCTGAATA GCTTGTGATCACCAGAATTTGTTAAGGAAAAATATGTTGATTCAAATTAAACATGCTATAATTACGATGAATGAAATGTT AATGACGAGGAATTTTGGAATTTATGTATGACAGGCTCACAGCTATAACTCAGTTGGTTCATCATGGAATGTTGTTTGTT CCAATTGGATATACATTTGGTGCTGGAATGTCTGTAATGGATGAACTGAAAGGTGGAAGTCCATATGGTTCAGGAACTTA TGCTGGTGATGGCTCAAGACAGCCCACAAAGCTTGAATTGGAGCAAGCATTTCACCAAGGGAAGTACATTGCTACCATCA CCAAGAAGCTCAAGGAAGCTGCTTAATGTTGA

Download Genomic Sequence

CDS sequence (LotjaGi3g1v0097700.4) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGGGGCACCACCAAAGAGTGATGTACCAATCATTACCCCTCATGAGCTCTCTGAGGGTGATGGATTTGTGTTTGGCTT CCCAACAAGATTTGGAATGATGGCTGCACAGTTTAAAGCTTTTCTAGATTCAACTGGAGGTCTATGGAAAACACAACAGC TTGCTGGCAAGCCTGCTGGACTCTTCTACAGCACAGGTTCCCAAGGTGGTGGGCAAGAGACAACAGCGCTCACAGCTATA ACTCAGTTGGTTCATCATGGAATGTTGTTTGTTCCAATTGGATATACATTTGGTGCTGGAATGTCTGTAATGGATGAACT GAAAGGTGGAAGTCCATATGGTTCAGGAACTTATGCTGGTGATGGCTCAAGACAGCCCACAAAGCTTGAATTGGAGCAAG CATTTCACCAAGGGAAGTACATTGCTACCATCACCAAGAAGCTCAAGGAAGCTGCTTAA

Download CDS Sequence

Protein sequence (LotjaGi3g1v0097700.4) extracted from Lotus japonicus Gifu v1.2 Proteins.

MGAPPKSDVPIITPHELSEGDGFVFGFPTRFGMMAAQFKAFLDSTGGLWKTQQLAGKPAGLFYSTGSQGGGQETTALTAI TQLVHHGMLFVPIGYTFGAGMSVMDELKGGSPYGSGTYAGDGSRQPTKLELEQAFHQGKYIATITKKLKEAA

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR30546 View details on PTHR30546 Search for proteins/transripts with this domain View external data on PTHR30546	1	152	152	1.1E-91	–
PANTHER	PTHR30546:SF32 View details on PTHR30546:SF32 Search for proteins/transripts with this domain View external data on PTHR30546:SF32	1	152	152	1.1E-91	–
Gene3D	G3DSA:3.40.50.360 View details on G3DSA:3.40.50.360 Search for proteins/transripts with this domain View external data on G3DSA:3.40.50.360	1	150	150	5.6E-55	IPR029039 Show description in modal box View details on IPR029039 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF52218 View details on SSF52218 Search for proteins/transripts with this domain View external data on SSF52218	5	149	145	1.06E-41	IPR029039 Show description in modal box View details on IPR029039 Search for proteins/transripts with this domain View on EBI InterPro Service
TIGRFAM	TIGR01755 View details on TIGR01755 Search for proteins/transripts with this domain View external data on TIGR01755	8	148	141	5.6E-49	IPR010089 Show description in modal box View details on IPR010089 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF03358 View details on PF03358 Search for proteins/transripts with this domain View external data on PF03358	19	93	75	5.2E-9	IPR005025 Show description in modal box View details on IPR005025 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0003955 View details of GO:0003955 AmiGO InterPro QuickGO	Molecular function	NAD(P)H dehydrogenase (quinone) activity	Catalysis of the reaction: NAD(P)H + H+ + a quinone = NAD(P)+ + a hydroquinone.	Subterm of View details of GO:0016655
GO:0010181 View details of GO:0010181 AmiGO InterPro QuickGO	Molecular function	FMN binding	Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.	Subterm of View details of GO:0032553 View details of GO:0043168 View details of GO:0050662
GO:0016491 View details of GO:0016491 AmiGO InterPro QuickGO	Molecular function	Oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.	Subterm of View details of GO:0003824

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0097700.4, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…