Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi3g1v0114700 |
Transcript ID | LotjaGi3g1v0114700.1 |
Lotus japonicus genome version | Gifu v1.2 |
Description | Major allergen d 1; TAIR: AT5G45870.1 PYR1-like 12; Swiss-Prot: sp|P93333|PR101_MEDTR Class-10 pathogenesis-related protein 1; TrEMBL-Plants: tr|I3SGW8|I3SGW8_LOTJA Uncharacterized protein; Found in the gene: LotjaGi3g1v0114700 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:14113688..14114794) extracted from Lotus japonicus Gifu genome v1.2.
CAACATTCAAGTATTCAACACACAGAACATACTTTTTGAATATGTGTCGCCATGACACCATCTTTGAATGCTTCCAACTC ACATTCTTTGAACAATATTCGTGAAATTCTTCAGATTTACATTGAAATCAAAATCAAACCAGCTTTGTTAATTTTTCCAT GAACAGAACGACATCACAAGATTATTAATAAAAAGAACTGACCTGGCAGAAACAATGAGAAGAGAAAACGCTCAACCCAA TGCATATAAATACTAGGCTCAGTTTTCCTCAAAAACCACACAAGCAAACAAATAAGCTCTTATTCTCGCACTACATAGCA GTCTCATTCTCCTTGTGTTAATTCATCATCATGGGTGTTCTTACTTTCACTGACGAGACCACCTCTGTTGTAGCTCCAGC AAGGCTTTTCAAAGCTTTGGTTACAGATGTTGATACCATCGTCCCAAAGGTTATTGATGCCTTCAAGAGTGTTGAAATTG TTGAAGGAAATGGAGGCGCCGGAACCGTAAAAAAGATCACTATCGTTGAAGATGGCGAAACCAAGTTTGTGTTGCACAAA ATTGATGCAATTGACGAGGCTAATTGGGGATACAACTACAGCATCGTTGGAGGTGTTGGGTTGCCAGACTCAGTTGAAAA GATTTCATTTGAGTCCAAATTGGATGCAGGGTCTAATGGAGGATCCATTGCAAAACTCACTGTTAACTTCTATACTAAAG GTGATGCTAAACCCACTGAAGAGGAGCTCAAAGTTGGAAAAGCTAAGGGTGATGGCCTTTTCAAGGCAATTGAGGGTTAT GTTTTGGCCAATCCTGATTACAACTAAAGCTTCTTTCTAAGTGCTTGCTTCTATATGGTGTGATCCATCACACACTGTTC AGTGTGCTTCATTTGGCTACAATTGTGATTCCCTTTTTTTCCCTTTTTCTTTTACTGAGGCGTAGCAGTGAGATTTCATC TCATGAGTACTTGTACCTCCCTTCATCAATAAATAATACGAAATGCTTGTTGTAACTTAATTAAATTCTCTGAAGAGTCA TCCATGATCAAAGGAAACATATTGAATAAACAAATCTCATTTGCCTGATCTCTAATTGAAATTTCTA
CDS sequence (LotjaGi3g1v0114700.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGGTGTTCTTACTTTCACTGACGAGACCACCTCTGTTGTAGCTCCAGCAAGGCTTTTCAAAGCTTTGGTTACAGATGT TGATACCATCGTCCCAAAGGTTATTGATGCCTTCAAGAGTGTTGAAATTGTTGAAGGAAATGGAGGCGCCGGAACCGTAA AAAAGATCACTATCGTTGAAGATGGCGAAACCAAGTTTGTGTTGCACAAAATTGATGCAATTGACGAGGCTAATTGGGGA TACAACTACAGCATCGTTGGAGGTGTTGGGTTGCCAGACTCAGTTGAAAAGATTTCATTTGAGTCCAAATTGGATGCAGG GTCTAATGGAGGATCCATTGCAAAACTCACTGTTAACTTCTATACTAAAGGTGATGCTAAACCCACTGAAGAGGAGCTCA AAGTTGGAAAAGCTAAGGGTGATGGCCTTTTCAAGGCAATTGAGGGTTATGTTTTGGCCAATCCTGATTACAACTAA
Protein sequence (LotjaGi3g1v0114700.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MGVLTFTDETTSVVAPARLFKALVTDVDTIVPKVIDAFKSVEIVEGNGGAGTVKKITIVEDGETKFVLHKIDAIDEANWG YNYSIVGGVGLPDSVEKISFESKLDAGSNGGSIAKLTVNFYTKGDAKPTEEELKVGKAKGDGLFKAIEGYVLANPDYN
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 1 | 157 | 157 | 3.6E-68 | – | |
Gene3D | 1 | 158 | 158 | 3.7E-53 | ||
Pfam | 1 | 154 | 154 | 1.5E-27 | ||
PANTHER | 1 | 157 | 157 | 3.6E-68 | – | |
SUPERFAMILY | 2 | 158 | 157 | 9.34E-40 | – | |
PRINTS | 3 | 23 | 21 | 1.4E-43 | ||
CDD | 5 | 151 | 147 | 1.54984E-48 | – | |
PRINTS | 26 | 36 | 11 | 1.4E-43 | ||
PRINTS | 49 | 58 | 10 | 1.4E-43 | ||
PRINTS | 65 | 84 | 20 | 1.4E-43 | ||
PRINTS | 84 | 97 | 14 | 1.4E-43 | ||
ProSitePatterns | 88 | 120 | 33 | - | ||
PRINTS | 109 | 125 | 17 | 1.4E-43 | ||
PRINTS | 143 | 153 | 11 | 1.4E-43 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | Protein phosphatase inhibitor activity | Stops, prevents or reduces the activity of a protein phosphatase, an enzyme that hydrolyzes phosphate groups from phosphorylated proteins. | ||
Biological process | Defense response | Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack. | ||
Biological process | Abscisic acid-activated signaling pathway | A series of molecular signals generated by the binding of the plant hormone abscisic acid (ABA) to a receptor, and ending with modulation of a cellular process, e.g. transcription. | ||
Molecular function | Abscisic acid binding | Interacting selectively and non-covalently with abscisic acid, plant hormones that regulate aspects of plant growth. | ||
Molecular function | Signaling receptor activity | Receiving a signal and transmitting it in the cell to initiate a change in cell activity. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response. |
Expression pattern of LotjaGi3g1v0114700.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…