Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0372900.2

Overview

Field	Value
Gene ID	LotjaGi3g1v0372900
Transcript ID	LotjaGi3g1v0372900.2
Related isoforms 3	LotjaGi3g1v0372900.1 LotjaGi3g1v0372900.3 LotjaGi3g1v0372900.4
Lotus japonicus genome version	Gifu v1.2
Description	Inositol oxygenase; TAIR: AT1G14520.1 myo-inositol oxygenase 1; Swiss-Prot: sp\|Q5Z8T3\|MIOX_ORYSJ Probable inositol oxygenase; TrEMBL-Plants: tr\|I3S3Z3\|I3S3Z3_LOTJA Uncharacterized protein; Found in the gene: LotjaGi3g1v0372900
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr3:76421765..76422692) extracted from Lotus japonicus Gifu genome v1.2.

CCACTTCAGCATTTTAAGGAGAACCCAGACTACAACAACCCTGCATACAACACTAGATATGGGATGTACTCAGAGAAATG TGGACTTAACAACGTGCTGATGTCATGGGGACATGATGACTACATGTATCTTGTAAGAACCTGAAAACCCCATGTGATTA TAAGTCTGTTTGGATACATGGTGGAAAATCACAGTTGAGCCAAAATCGTGGTGGACAGATTTGTGACTGTCGACCATGAT TTTGGCCTTACCGAGATTTTCCAATATATCCAAACAATTCAATGCAATTATTTCATAAACAGTGAGGAAAAGGTCTAAAG TATATACTCTCTGTCTTCAGGTGGCAAAGGAGAATAAGACTACTCTGCCTTCAGCTGCTCTGTTCATTATCAGATACCAT TCATTCTATGGTAAGTCTAACTTAAAGAAGTAATTAATGTTCCCATGTTAATCATTTAATCATAAGCCTATAACATATCA AATGGTCCATTTTGCAATTTGTTTGATATCATCATTTGTTTTGCAGCTTTACATAGGGAAGGAGCCTATAAGCACTTGAT GAATGAAGAGGATTTTGAGAATCTGGAATGGCTCCACATTTTCAAGTAACACCATTACATGATCTTCATATTTAGCAATT AAGTTTGCAAAATTTTGTTAAATTTTTTTCTAACTTCCTTCTACATTCACTCACTTGCAGCAAATACGACCTCTATAGCA AGAGCAAAGTTCGAATTGATGTTGAAAAGGTCAAGCCATACTATCTCTCTCTCATTGAAAAGGTAAGCACTGCTAGAAAA ATTTGTATTTCCTCTCCTTCTGAAAAAGAAATAAAAAAGTTGTTGTCTTTACCTAGTTAATTTTGAGCTTGTACTAATTA ATGTATTTTTCTTTTCTGCAGTACTTTCCTGCAAAGCTAAAGTGGTGA

Download Genomic Sequence

CDS sequence (LotjaGi3g1v0372900.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTACTCAGAGAAATGTGGACTTAACAACGTGCTGATGTCATGGGGACATGATGACTACATGTATCTTGTGGCAAAGGA GAATAAGACTACTCTGCCTTCAGCTGCTCTGTTCATTATCAGATACCATTCATTCTATGCTTTACATAGGGAAGGAGCCT ATAAGCACTTGATGAATGAAGAGGATTTTGAGAATCTGGAATGGCTCCACATTTTCAACAAATACGACCTCTATAGCAAG AGCAAAGTTCGAATTGATGTTGAAAAGGTCAAGCCATACTATCTCTCTCTCATTGAAAAGTACTTTCCTGCAAAGCTAAA GTGGTGA

Download CDS Sequence

Protein sequence (LotjaGi3g1v0372900.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MYSEKCGLNNVLMSWGHDDYMYLVAKENKTTLPSAALFIIRYHSFYALHREGAYKHLMNEEDFENLEWLHIFNKYDLYSK SKVRIDVEKVKPYYLSLIEKYFPAKLKW

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
SUPERFAMILY	SSF109604 View details on SSF109604 Search for proteins/transripts with this domain View external data on SSF109604	1	108	108	4.71E-51	–
PANTHER	PTHR12588:SF3 View details on PTHR12588:SF3 Search for proteins/transripts with this domain View external data on PTHR12588:SF3	1	108	108	2.6E-65	–
PANTHER	PTHR12588 View details on PTHR12588 Search for proteins/transripts with this domain View external data on PTHR12588	1	108	108	2.6E-65	IPR007828 Show description in modal box View details on IPR007828 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF05153 View details on PF05153 Search for proteins/transripts with this domain View external data on PF05153	1	108	108	4.7E-52	IPR007828 Show description in modal box View details on IPR007828 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0005506 View details of GO:0005506 AmiGO InterPro QuickGO	Molecular function	Iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.	Subterm of View details of GO:0046914
GO:0005737 View details of GO:0005737 AmiGO InterPro QuickGO	Cellular component	Cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.	Subterm of View details of GO:0044424
GO:0019310 View details of GO:0019310 AmiGO InterPro QuickGO	Biological process	Inositol catabolic process	The chemical reactions and pathways resulting in the breakdown of inositol, 1,2,3,4,5,6-cyclohexanehexol, a growth factor for animals and microorganisms.	Subterm of View details of GO:0006020 View details of GO:0044275 View details of GO:0046174
GO:0050113 View details of GO:0050113 AmiGO InterPro QuickGO	Molecular function	Inositol oxygenase activity	Catalysis of the reaction: myo-inositol + O(2) = D-glucuronate + H(2)O + H(+).	Subterm of View details of GO:0016701
GO:0055114 View details of GO:0055114 AmiGO InterPro QuickGO	Biological process	Oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.	Subterm of View details of GO:0008152

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0372900.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…