Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi3g1v0446300 |
| Transcript ID | LotjaGi3g1v0446300.2 |
| Related isoforms 2 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Phospholipid-transporting ATPase; TAIR: AT5G44240.1 aminophospholipid ATPase 2; Swiss-Prot: sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2; TrEMBL-Plants: tr|A0A151SEZ0|A0A151SEZ0_CAJCA Phospholipid-transporting ATPase; Found in the gene: LotjaGi3g1v0446300 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:85947892..85948358) extracted from Lotus japonicus Gifu genome v1.2.
AAATTAACATTGATCGTAAGGATCTAGCGAGGAGCCAAATTCATACACACTTTATTTTTGGGTTAAACATTGTATCTATT GAATTGCATTGATTATTCTCTGATTGGAACTATATTTTCATACAGCTCATGACTGCAGCCGGAATGGGTCCAATTCTAGC CATCAAGTACTTTCGATATACATATAGGTCAAGCAAAATCAATGCACTTCAGCAGGCTGAACGCCAAGGGGGACCAATTT TGTCTCTTGGCACCATTGAGCCTCAGCCCAGATCTATAGAGAAAGATGTTTCTACCTTGTCAATAACACAACCCAAAATC AGAAATCCTGTTTATGAACCTCTTTTATCAGATTCTCCAAATTCCACCAGAAGATCTTTTGGAGCAGCGACACCATTTGA TTTTTTTCAGTCTCAGTCAAGATTATCACTTTCTAGTAGCTACACAAGAAATTGCAAGGACAACTGA
CDS sequence (LotjaGi3g1v0446300.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGACTGCAGCCGGAATGGGTCCAATTCTAGCCATCAAGTACTTTCGATATACATATAGGTCAAGCAAAATCAATGCACT TCAGCAGGCTGAACGCCAAGGGGGACCAATTTTGTCTCTTGGCACCATTGAGCCTCAGCCCAGATCTATAGAGAAAGATG TTTCTACCTTGTCAATAACACAACCCAAAATCAGAAATCCTGTTTATGAACCTCTTTTATCAGATTCTCCAAATTCCACC AGAAGATCTTTTGGAGCAGCGACACCATTTGATTTTTTTCAGTCTCAGTCAAGATTATCACTTTCTAGTAGCTACACAAG AAATTGCAAGGACAACTGA
Protein sequence (LotjaGi3g1v0446300.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MTAAGMGPILAIKYFRYTYRSSKINALQQAERQGGPILSLGTIEPQPRSIEKDVSTLSITQPKIRNPVYEPLLSDSPNST RRSFGAATPFDFFQSQSRLSLSSSYTRNCKDN
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| PANTHER | 3 | 110 | 108 | 7.1E-20 | – | |
| PANTHER | 3 | 110 | 108 | 7.1E-20 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | Magnesium ion binding | Interacting selectively and non-covalently with magnesium (Mg) ions. | ||
| Molecular function | ATP binding | Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator. | ||
| Biological process | Phospholipid transport | The directed movement of phospholipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Phospholipids are any lipids containing phosphoric acid as a mono- or diester. | ||
| Cellular component | Integral component of membrane | The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane. | ||
Expression pattern of LotjaGi3g1v0446300.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…