Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi4g1v0000700 |
| Transcript ID | LotjaGi4g1v0000700.2 |
| Related isoforms 1 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Outer envelope pore 37, chloroplastic-like protein; TAIR: AT2G43950.1 chloroplast outer envelope protein 37; Swiss-Prot: sp|Q4LDF9|OEP37_PEA Outer envelope pore protein 37, chloroplastic; TrEMBL-Plants: tr|A0A1J7GMD8|A0A1J7GMD8_LUPAN Uncharacterized protein; Found in the gene: LotjaGi4g1v0000700 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr4:133704..134285) extracted from Lotus japonicus Gifu genome v1.2.
AATACCCTTAAAACATTAAGCTTGTCTCCTTGCTGACATGAATTTTTCAATATTTTATGGATAGTTACTGGTACAATTGT GATTCCAACTATTGGAGTGCTGTCTACAAGCATACCTATGGTAAAGATTTCAAATTTAAAGCTGGTTATGATTCAGAGGT TCGCCTTGGCTGGGCATCCCTTTGGGTATGTGTTTAATTTTGCAATTATGAAATATGCTATCCTTGCAGTTATTATTCCT CATACACAACTACTCTGCATTTTTTAACTGTGGCTTCTTAACTCTGTCCATCCTTTTACGCAGGCCATACATATTAGCTG TTTGTTAAGTTTGAGCTCTTATCTTTCAAAATAATAATTATTGATAGCTTCCGTAGATGTACTGCACCTGTATTGTGATT TTACAGGCTTAGGTTAGACATCACATGACATGCTATCCTGCTTCATTCAGGTTGGAGATGAAGGTGGAAAAGCCAAAACT GCTCCGATGAAGATGAAAGTTCAATTCATGCTTCAAGTGCCACAAGACGATATCAAATCTTCAGCTTTGATGTTTCGAGT TAAGAAGAGATGGGACATATAA
CDS sequence (LotjaGi4g1v0000700.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGATAGTTACTGGTACAATTGTGATTCCAACTATTGGAGTGCTGTCTACAAGCATACCTATGGTAAAGATTTCAAATT TAAAGCTGGTTATGATTCAGAGGTTCGCCTTGGCTGGGCATCCCTTTGGGTTGGAGATGAAGGTGGAAAAGCCAAAACTG CTCCGATGAAGATGAAAGTTCAATTCATGCTTCAAGTGCCACAAGACGATATCAAATCTTCAGCTTTGATGTTTCGAGTT AAGAAGAGATGGGACATATAA
Protein sequence (LotjaGi4g1v0000700.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MDSYWYNCDSNYWSAVYKHTYGKDFKFKAGYDSEVRLGWASLWVGDEGGKAKTAPMKMKVQFMLQVPQDDIKSSALMFRV KKRWDI
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| PANTHER | 3 | 86 | 84 | 2.1E-55 | – | |
| PANTHER | 3 | 86 | 84 | 2.1E-55 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | Ion channel activity | Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size). | ||
| Biological process | Cation transport | The directed movement of cations, atoms or small molecules with a net positive charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. |
Expression pattern of LotjaGi4g1v0000700.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…