Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi4g1v0084200 |
| Transcript ID | LotjaGi4g1v0084200.1 |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Cox19-like CHCH family protein; TAIR: AT1G47278.2 hypothetical protein; Swiss-Prot: sp|Q6BSK5|ATG17_DEBHA Autophagy-related protein 17; TrEMBL-Plants: tr|I3SNX9|I3SNX9_LOTJA Uncharacterized protein; Found in the gene: LotjaGi4g1v0084200 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr4:11053746..11054117) extracted from Lotus japonicus Gifu genome v1.2.
ATGGGGCGGAAAGCTGGCGGGCTTTATATCAACCCTAAGAGGTTTGGTCAACTTCATAAACCTTGCATGAAGGAAATGAC AATGTTTCTCAACTGTATGGCTACATGCAATAGTGACATTAATGCATGTGCTCAGCAGAAGGAACTATTAAATGCCTGTA TCGATTCTCAGGTAACATAGATATATACTGGCATCTTTTCTCGCCCTCCCTGGTTCTCGGGGTTTCCTTTTTTTTTAGTT GTTATCATATTACGTCAGAACTAAGTAGTCCTTAAAAACTGTGCAACTTTGTTTTTTCAGAGTAAAAAGAAAAGAAACTC TTGGGGGAGCATCAATTATCAGCTGCAGAGGCTTAGCCGAGGAAGGAAGTAG
CDS sequence (LotjaGi4g1v0084200.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGGGCGGAAAGCTGGCGGGCTTTATATCAACCCTAAGAGGTTTGGTCAACTTCATAAACCTTGCATGAAGGAAATGAC AATGTTTCTCAACTGTATGGCTACATGCAATAGTGACATTAATGCATGTGCTCAGCAGAAGGAACTATTAAATGCCTGTA TCGATTCTCAGAGTAAAAAGAAAAGAAACTCTTGGGGGAGCATCAATTATCAGCTGCAGAGGCTTAGCCGAGGAAGGAAG TAG
Protein sequence (LotjaGi4g1v0084200.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MGRKAGGLYINPKRFGQLHKPCMKEMTMFLNCMATCNSDINACAQQKELLNACIDSQSKKKRNSWGSINYQLQRLSRGRK
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| PANTHER | 1 | 80 | 80 | 8.1E-37 | ||
| SUPERFAMILY | 19 | 70 | 52 | 2.33E-5 | ||
| Pfam | 20 | 57 | 38 | 3.6E-8 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | Structural constituent of ribosome | The action of a molecule that contributes to the structural integrity of the ribosome. | ||
| Biological process | Mitochondrial translation | The chemical reactions and pathways resulting in the formation of a protein in a mitochondrion. This is a ribosome-mediated process in which the information in messenger RNA (mRNA) is used to specify the sequence of amino acids in the protein; the mitochondrion has its own ribosomes and transfer RNAs, and uses a genetic code that differs from the nuclear code. |
Expression pattern of LotjaGi4g1v0084200.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…