Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi4g1v0202400.1

Overview

Field	Value
Gene ID	LotjaGi4g1v0202400
Transcript ID	LotjaGi4g1v0202400.1
Lotus japonicus genome version	Gifu v1.2
Description	Polynucleotidyl transferase, ribonuclease H-like superfamily protein; TAIR: AT5G61090.1 Polynucleotidyl transferase, ribonuclease H-like superfamily protein; Swiss-Prot: sp\|P0C2F6\|RNHX1_ARATH Putative ribonuclease H protein At1g65750; TrEMBL-Plants: tr\|A0A151RY69\|A0A151RY69_CAJCA Putative ribonuclease H protein family; Found in the gene: LotjaGi4g1v0202400
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr4:46876597..46877536) extracted from Lotus japonicus Gifu genome v1.2.

GTCATTGTGAAGGTGGATACAGCGACACTCGCGATGGCGGTGGATCTCGCTACTCTAACGGTGGAAGCTGGAGGGATTAG AGATTTATGATATGTTTAGTTGCTATAATGTACTAGTTTTAAGTTTGCATATTTTGTTATGGTTTCGTCGTCATGTGGTT CTCGTTTAATACTCTCTGAATCTAGTTGTGTATGAATGCTCCCTTCAGAGTTTGGTTATATGCTCAGTTACAGCTACAGA ATAATGCTCTGTTTTGTGCAGTTGTCTGGAACTTGTGGAAATGGAGAAACAGTTTTGCTTTTGATCAAACACCATGGCAC CCAAGGGAGGTCTTGCGGCGAGTTCATCTGGATGTCCTGGAGTTCCAGCGATGGGGATCGGGGTCAGTTCCACACAACAT AGTGCATACCCAGGGGGAGAAGAGCATGTCTCTTCATACGGATGGAAGCTGGCAGCAACACATCAACATGATGGGCGGTG GCGGTGTTATCCAGGATAACATGGGTCGCTGGGTATCCGGGTTCGCGGTGGTGCTTGGGCCCGGAGACGCGTTCAAGGCG GAAATAGTGGCTCTGACTCGGGGACTTGGTCATGCCTGGAACCTTGGGTATCGAGACATAGATTGCTTTGTGGACTGCTT AGAATTGCAGATGGTGCTTGCAAGTGATGAGGATGTGCAGCATTTCTGGCATAGGGAGGAAATTCAAGCAGCCTGTGCAA TGCTAGCGAAGAACTGGAAGGTGACGGTTAGGCATGTCCCTCGGGAGCGGAACCAGGTAGCCGACGCCATGGCCAAACTT GCTGTTCGAGATCGTTGCGATTGGAAAATTTGGAGTGTTCCCCCTTCTGATGTGATTCCCCTGCTTTGCCAGGACTTTGT TGTTTAGCTTTCTGTTGTTTATTTCCTCATTGTACCAAAAAAAAAGTTGTGTATGAATGG

Download Genomic Sequence

CDS sequence (LotjaGi4g1v0202400.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTCTCTTCATACGGATGGAAGCTGGCAGCAACACATCAACATGATGGGCGGTGGCGGTGTTATCCAGGATAACATGGG TCGCTGGGTATCCGGGTTCGCGGTGGTGCTTGGGCCCGGAGACGCGTTCAAGGCGGAAATAGTGGCTCTGACTCGGGGAC TTGGTCATGCCTGGAACCTTGGGTATCGAGACATAGATTGCTTTGTGGACTGCTTAGAATTGCAGATGGTGCTTGCAAGT GATGAGGATGTGCAGCATTTCTGGCATAGGGAGGAAATTCAAGCAGCCTGTGCAATGCTAGCGAAGAACTGGAAGGTGAC GGTTAGGCATGTCCCTCGGGAGCGGAACCAGGTAGCCGACGCCATGGCCAAACTTGCTGTTCGAGATCGTTGCGATTGGA AAATTTGGAGTGTTCCCCCTTCTGATGTGATTCCCCTGCTTTGCCAGGACTTTGTTGTTTAG

Download CDS Sequence

Protein sequence (LotjaGi4g1v0202400.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSLHTDGSWQQHINMMGGGGVIQDNMGRWVSGFAVVLGPGDAFKAEIVALTRGLGHAWNLGYRDIDCFVDCLELQMVLAS DEDVQHFWHREEIQAACAMLAKNWKVTVRHVPRERNQVADAMAKLAVRDRCDWKIWSVPPSDVIPLLCQDFVV

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
ProSiteProfiles	PS50879 View details on PS50879 Search for proteins/transripts with this domain View external data on PS50879	1	128	128	10.36	IPR002156 Show description in modal box View details on IPR002156 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:3.30.420.10 View details on G3DSA:3.30.420.10 Search for proteins/transripts with this domain View external data on G3DSA:3.30.420.10	1	129	129	4.8E-19	IPR036397 Show description in modal box View details on IPR036397 Search for proteins/transripts with this domain View on EBI InterPro Service
PANTHER	PTHR46736:SF5 View details on PTHR46736:SF5 Search for proteins/transripts with this domain View external data on PTHR46736:SF5	2	151	150	1.2E-27	–
PANTHER	PTHR46736 View details on PTHR46736 Search for proteins/transripts with this domain View external data on PTHR46736	2	151	150	1.2E-27	–
SUPERFAMILY	SSF53098 View details on SSF53098 Search for proteins/transripts with this domain View external data on SSF53098	2	129	128	7.21E-17	IPR012337 Show description in modal box View details on IPR012337 Search for proteins/transripts with this domain View on EBI InterPro Service
CDD	cd06222 View details on cd06222 Search for proteins/transripts with this domain View external data on cd06222	3	124	122	8.00854E-30	–
Pfam	PF13456 View details on PF13456 Search for proteins/transripts with this domain View external data on PF13456	5	126	122	2.0E-23	IPR002156 Show description in modal box View details on IPR002156 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0003676 View details of GO:0003676 AmiGO InterPro QuickGO	Molecular function	Nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.	Subterm of View details of GO:0097159 View details of GO:1901363
GO:0004523 View details of GO:0004523 AmiGO InterPro QuickGO	Molecular function	RNA-DNA hybrid ribonuclease activity	Catalysis of the endonucleolytic cleavage of RNA in RNA-DNA hybrids to 5'-phosphomonoesters.	Subterm of View details of GO:0016891

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi4g1v0202400.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…