Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi4g1v0235300.3

Overview

Field	Value
Gene ID	LotjaGi4g1v0235300
Transcript ID	LotjaGi4g1v0235300.3
Related isoforms 2	LotjaGi4g1v0235300.1 LotjaGi4g1v0235300.2
Lotus japonicus genome version	Gifu v1.2
Description	Phosphoglycerate mutase; TAIR: AT5G62840.2 Phosphoglycerate mutase family protein; Swiss-Prot: sp\|Q9R6X3\|PHYB_NOSS1 Cyanobacterial phytochrome B; TrEMBL-Plants: tr\|V7CDP2\|V7CDP2_PHAVU Uncharacterized protein; Found in the gene: LotjaGi4g1v0235300
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr4:54948660..54949122) extracted from Lotus japonicus Gifu genome v1.2.

ATTCTCCAGATATATGTATCAGATGGAATGTCTCCAAACATCAAACCTCCCCCCACTAATGATGGAACTCCAAATGAGTG TGTTGCAGATGTTTTTGTTCGTGTGACACAACTCATGTCAATTCTTGAAACTCAATACTCCGGTGACACGGTTGTTATAG TCTCGCCAGATTCTGACAACTTGTCAATCCTTCAGGCTGGTTTGATAGGGCTAGACCTGCGAAGGTAACTGAATGATGGA TAGTCCTAAGTCCTAGCTCCTGTTATAGTGTGTATGAATTTAATTAAGGCTTCAATCTGGTACTCAGTTTGTTTCCTTTT ATGCTTGCTTAACTTTCAGGCACAGGGATTTGTCTTTTGCACCTGGTGAAGTTCGCTTTGTTGATACCAGTGACATTCCT GCTTACAAGCAGCCCCCATCTCGTGTATATAAATGTTTGAAGCCGCCACCAAATTGTAACTAG

Download Genomic Sequence

CDS sequence (LotjaGi4g1v0235300.3) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTCTCCAAACATCAAACCTCCCCCCACTAATGATGGAACTCCAAATGAGTGTGTTGCAGATGTTTTTGTTCGTGTGAC ACAACTCATGTCAATTCTTGAAACTCAATACTCCGGTGACACGGTTGTTATAGTCTCGCCAGATTCTGACAACTTGTCAA TCCTTCAGGCTGGTTTGATAGGGCTAGACCTGCGAAGGCACAGGGATTTGTCTTTTGCACCTGGTGAAGTTCGCTTTGTT GATACCAGTGACATTCCTGCTTACAAGCAGCCCCCATCTCGTGTATATAAATGTTTGAAGCCGCCACCAAATTGTAACTA G

Download CDS Sequence

Protein sequence (LotjaGi4g1v0235300.3) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSPNIKPPPTNDGTPNECVADVFVRVTQLMSILETQYSGDTVVIVSPDSDNLSILQAGLIGLDLRRHRDLSFAPGEVRFV DTSDIPAYKQPPSRVYKCLKPPPNCN

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR47580 View details on PTHR47580 Search for proteins/transripts with this domain View external data on PTHR47580	2	106	105	1.0E-55	–
SUPERFAMILY	SSF53254 View details on SSF53254 Search for proteins/transripts with this domain View external data on SSF53254	15	82	68	7.77E-5	IPR029033 Show description in modal box View details on IPR029033 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

Unable to find any GO terms for the transcript with the identifier.

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi4g1v0235300.3, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…