Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi5g1v0035400.1

Overview

Field	Value
Gene ID	LotjaGi5g1v0035400
Transcript ID	LotjaGi5g1v0035400.1
Lotus japonicus genome version	Gifu v1.2
Description	Transcription factor; TAIR: AT3G49760.1 basic leucine-zipper 5; Swiss-Prot: sp\|Q9SI15\|BZIP2_ARATH bZIP transcription factor 2; TrEMBL-Plants: tr\|A0A1J7IS28\|A0A1J7IS28_LUPAN Uncharacterized protein; Found in the gene: LotjaGi5g1v0035400
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr5:5902807..5904107) extracted from Lotus japonicus Gifu genome v1.2.

CCTCCTTACCTCCCTCCGGTTCATTGTTTAGAAACATACCGGTTTTTTTCTCCTATAGTAATTGTTGTTGTAGCTAGCAA TGTTGTTCCAGGACGAGGAAGCGGTCCAGTTCTCATGTCCTATGGTTCACGAAGCCATGTTCACGTCAAGTGAAATAGAG GAGCTGTTTTCACTCATCAACCAGCCCGATGATCCGTCCAGCCCAGGATCTGGTTCACAGGGGTCGAACCGGGCGGTTTA CTCCGCGCAAGAGAGAAAGATAAGGAGAATGCAGTCAAACCGGGAGTCGGCCAGGCGGTCCCGTTGGAGAAAGAAGAGGC ATTTGGAGAATCTCACAAACCAATTGAACCGATTGAGAATTGAAAACCGGGAACTGAAAAACCGGCTCACCTCGACGGTG CACCACCATCTCCTACTATCCGTGGAGAATGAATGTCTAATATCCGAATCCATGACCCTTATGGCCGAACTTTCGGATCC ATGTCAAATTTCAAGCACCATGTTTTCACAATAGAAGCAAATTACAAAGGCTAGGCATTGAGCTTGAGCTTGAGTAGACT TTGATAACTAAAACACTATAACAACAACAAAATGAGATCATGTGTATATCACGCTTAGTACTTTACTAGCTAAATAAATA AAGCTCTATGAATATGCCATTGTTTCTCTCCTTCACGCACTGAACCATTTTGGGTGCACTAGGGTAGGGAAAGTTAAAGC TAGAGGCTATCTAGTACTTTCAAGCTTTAATTTTTCTTTTTGTGAGAAGTTTATTTTGATTTCATGCATGTGGTGGTTTA ATTTCGAGTAACCCCACGTTGTTGGAAGCAGATCGAACGTAGAGAGATTTAGGGGCATGTTGTTATCTACTTTTTAATAT GGTGTCACTTTTGTCTTTTGGTAGCTTTTGTAAATTGTAAGAGATTAGTGAGTGATGAAACCAAAGGAGAGATGGTGAGA GTTCTAGTTTATTTGAGTCTCTATCGGATCGGAATCTTCATGGAATATATTGTTTGTGTGTCAATGTAGGTCATGATTCC ATGTAAATACGCAAGGTATGGACCAATTAAGCAATTAGAAATTTAATGACATATTGTTTCTTCTTTTTGTGTCTTTTGGA TAATCGTCAACTATATAAAATTGACTATGACCTGATTTTGAGAGTAATGATATCTACACACCTCATTTTTTAAACACTTC ATTTCCACATATTTTTGTTTCTACCTCTCTCATCTTATTATCTATCACATCTCATACTTTCTCTCTCTTACTTTTTCTTT TCTTTCTATCTCTCTCCTCCT

Download Genomic Sequence

CDS sequence (LotjaGi5g1v0035400.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTTGTTCCAGGACGAGGAAGCGGTCCAGTTCTCATGTCCTATGGTTCACGAAGCCATGTTCACGTCAAGTGAAATAGA GGAGCTGTTTTCACTCATCAACCAGCCCGATGATCCGTCCAGCCCAGGATCTGGTTCACAGGGGTCGAACCGGGCGGTTT ACTCCGCGCAAGAGAGAAAGATAAGGAGAATGCAGTCAAACCGGGAGTCGGCCAGGCGGTCCCGTTGGAGAAAGAAGAGG CATTTGGAGAATCTCACAAACCAATTGAACCGATTGAGAATTGAAAACCGGGAACTGAAAAACCGGCTCACCTCGACGGT GCACCACCATCTCCTACTATCCGTGGAGAATGAATGTCTAATATCCGAATCCATGACCCTTATGGCCGAACTTTCGGATC CATGTCAAATTTCAAGCACCATGTTTTCACAATAG

Download CDS Sequence

Protein sequence (LotjaGi5g1v0035400.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MLFQDEEAVQFSCPMVHEAMFTSSEIEELFSLINQPDDPSSPGSGSQGSNRAVYSAQERKIRRMQSNRESARRSRWRKKR HLENLTNQLNRLRIENRELKNRLTSTVHHHLLLSVENECLISESMTLMAELSDPCQISSTMFSQ

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR45764 View details on PTHR45764 Search for proteins/transripts with this domain View external data on PTHR45764	2	144	143	2.2E-66	–
PANTHER	PTHR45764:SF29 View details on PTHR45764:SF29 Search for proteins/transripts with this domain View external data on PTHR45764:SF29	2	144	143	2.2E-66	–
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	33	54	22	-	–
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	33	79	47	-	–
Coils	Coil View details on Coil Search for proteins/transripts with this domain	54	102	49	-	–
SMART	SM00338 View details on SM00338 Search for proteins/transripts with this domain View external data on SM00338	55	119	65	4.1E-10	IPR004827 Show description in modal box View details on IPR004827 Search for proteins/transripts with this domain View on EBI InterPro Service
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	56	71	16	-	–
ProSiteProfiles	PS50217 View details on PS50217 Search for proteins/transripts with this domain View external data on PS50217	57	103	47	10.266	IPR004827 Show description in modal box View details on IPR004827 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF00170 View details on PF00170 Search for proteins/transripts with this domain View external data on PF00170	58	104	47	1.7E-8	IPR004827 Show description in modal box View details on IPR004827 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:1.20.5.170 View details on G3DSA:1.20.5.170 Search for proteins/transripts with this domain View external data on G3DSA:1.20.5.170	59	110	52	2.7E-10	–
SUPERFAMILY	SSF57959 View details on SSF57959 Search for proteins/transripts with this domain View external data on SSF57959	59	112	54	4.58E-11	–
CDD	cd14702 View details on cd14702 Search for proteins/transripts with this domain View external data on cd14702	60	110	51	4.52695E-15	–
ProSitePatterns	PS00036 View details on PS00036 Search for proteins/transripts with this domain View external data on PS00036	62	77	16	-	IPR004827 Show description in modal box View details on IPR004827 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0003700 View details of GO:0003700 AmiGO InterPro QuickGO	Molecular function	DNA-binding transcription factor activity	A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within the regulatory region of a gene to modulate transcription. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.	Subterm of View details of GO:0140110
GO:0006355 View details of GO:0006355 AmiGO InterPro QuickGO	Biological process	Regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.	Subterm of View details of GO:0010468 View details of GO:1903506 View details of GO:2000112 Regulates View details of GO:0006351

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi5g1v0035400.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…