Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi1g1v0417600.3

Overview

Field	Value
Gene ID	LotjaGi1g1v0417600
Transcript ID	LotjaGi1g1v0417600.3
Related isoforms 2	LotjaGi1g1v0417600.1 LotjaGi1g1v0417600.2
Lotus japonicus genome version	Gifu v1.2
Description	Metalloendopeptidase/zinc ion-binding protein; TAIR: AT5G42620.1 metalloendopeptidase / zinc ion binding protein; Swiss-Prot: sp\|Q08875\|SUHW_DROAN Protein suppressor of hairy wing; TrEMBL-Plants: tr\|A0A0B2PA32\|A0A0B2PA32_GLYSO Leishmanolysin-like peptidase; Found in the gene: LotjaGi1g1v0417600
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr1:91151864..91152504) extracted from Lotus japonicus Gifu genome v1.2.

ATGCTTCTGTCTAGTCTTTCTGTTTGCAAAAATGTGCTGGAAAAGGATGTTTCTGGACAGCTTTGTGCACCCAGCGAACC TAGCATTCTACAGCAGCTGGAAGAAGTTGTTGTCGTTCCCAACTACCATCGATTATTCCCAGGTGGTGCTCGGAAATTAT TTAATATATTTGGCAGTACCTACTGTGATGAGGCTGCTAAACGGCTTGCCTGCTGGGTAAGTTGTCTTATCATACTGAAG TTATTCTGTAGGTTCCCTTGTTTTGTAATGTTATTTAGTCATGCTCAAGCTGAAACTTGGGGTTGAATTGTAATGCTTTT CTAACACTTTCTAGAGCATAGTTGGTAAGGTTACCTATTTGTCTAATGAGTTTGGCGCTTGATTTTCAGATCTCAATCCA AAAGTGTGACAAGGATGGAGACAACAGGCTTAGAGTGTGCCATTCTGCATGCCAATCTTATAATTTAGCATGTGGAGCTT CACTTGACTGCTCTGACCAAACCCTTTTCAGTAATGAGGGGGAGGGAGAGGGTCAATGCACCGGCTCTGGTGAGATGAAA TTGTCATGGTTCAATCGGCTGCGTCTTAGTTTTTCTTTGAGAAATAGTTCCTTGAAAGGAATATCAGTAAGATATAGGTA A

Download Genomic Sequence

CDS sequence (LotjaGi1g1v0417600.3) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGCTTCTGTCTAGTCTTTCTGTTTGCAAAAATGTGCTGGAAAAGGATGTTTCTGGACAGCTTTGTGCACCCAGCGAACC TAGCATTCTACAGCAGCTGGAAGAAGTTGTTGTCGTTCCCAACTACCATCGATTATTCCCAGGTGGTGCTCGGAAATTAT TTAATATATTTGGCAGTACCTACTGTGATGAGGCTGCTAAACGGCTTGCCTGCTGGATCTCAATCCAAAAGTGTGACAAG GATGGAGACAACAGGCTTAGAGTGTGCCATTCTGCATGCCAATCTTATAATTTAGCATGTGGAGCTTCACTTGACTGCTC TGACCAAACCCTTTTCAGTAATGAGGGGGAGGGAGAGGGTCAATGCACCGGCTCTGGTGAGATGAAATTGTCATGGTTCA ATCGGCTGCGTCTTAGTTTTTCTTTGAGAAATAGTTCCTTGAAAGGAATATCAGTAAGATATAGGTAA

Download CDS Sequence

Protein sequence (LotjaGi1g1v0417600.3) extracted from Lotus japonicus Gifu v1.2 Proteins.

MLLSSLSVCKNVLEKDVSGQLCAPSEPSILQQLEEVVVVPNYHRLFPGGARKLFNIFGSTYCDEAAKRLACWISIQKCDK DGDNRLRVCHSACQSYNLACGASLDCSDQTLFSNEGEGEGQCTGSGEMKLSWFNRLRLSFSLRNSSLKGISVRYR

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR10942:SF39 View details on PTHR10942:SF39 Search for proteins/transripts with this domain View external data on PTHR10942:SF39	1	147	147	2.3E-86	–
PANTHER	PTHR10942 View details on PTHR10942 Search for proteins/transripts with this domain View external data on PTHR10942	1	147	147	2.3E-86	IPR001577 Show description in modal box View details on IPR001577 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF63501 View details on SSF63501 Search for proteins/transripts with this domain View external data on SSF63501	53	108	56	2.35E-5	IPR036790 Show description in modal box View details on IPR036790 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0004222 View details of GO:0004222 AmiGO InterPro QuickGO	Molecular function	Metalloendopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.	Subterm of View details of GO:0004175 View details of GO:0008237
GO:0005515 View details of GO:0005515 AmiGO InterPro QuickGO	Molecular function	Protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).	Subterm of View details of GO:0005488
GO:0006508 View details of GO:0006508 AmiGO InterPro QuickGO	Biological process	Proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.	Subterm of View details of GO:0019538
GO:0007155 View details of GO:0007155 AmiGO InterPro QuickGO	Biological process	Cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.	Subterm of View details of GO:0022610
GO:0016020 View details of GO:0016020 AmiGO InterPro QuickGO	Cellular component	Membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.	Subterm of View details of GO:0005575

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi1g1v0417600.3, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…