Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi1g1v0700700.1

Overview

Field	Value
Gene ID	LotjaGi1g1v0700700
Transcript ID	LotjaGi1g1v0700700.1
Lotus japonicus genome version	Gifu v1.2
Description	response regulator 24; TAIR: AT5G26594.1 response regulator 24; Swiss-Prot: sp\|Q9M8Y4\|ARR22_ARATH Two-component response regulator ARR22; TrEMBL-Plants: tr\|A0A1J7HTJ5\|A0A1J7HTJ5_LUPAN Uncharacterized protein; Found in the gene: LotjaGi1g1v0700700
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr1:126879241..126880038) extracted from Lotus japonicus Gifu genome v1.2.

AGAAAAGAAGGCATATTTTTTTGGTGGGGGAAGTGAAGAACAATTGAAACAATGGATGCTCGTCAATTAACCGCACTTGT TGTTGATGATGACATCATTGTCCGAATGATATATGGAAAGATGTTGAACAGAGTTGGTGTGAAAAATCAAGTCGTGGAGA ATGGGAAAGAAGCTATAGACATTCACTGCTCTGGTCAAAGCTTTGACCTTATTTTCATGGACAAGGACATGCCTGTTATG AATGGCATTGAGGTAATTATCAACTCTACATTTCACACTTACTCAACAATCTTACAATTTTTTTTTGTCTTTTGATTGAT GTTAAGATCCCACTGATCTAGAACTATAGTTGTCTCTTATAATTAACAATTATTTTTTAATTGAACTTGTGTTTTCACAC CCTTACAAAAATCTAGTTTGAGTTTATTAATTTTTTTTGAAATGTAATGGAGTTTATTAATGTTACAATTTATGATTTTT TTATTGATGAGGAGTAAACTATAAAAAAGTTCTAAGTCATGACAATTGACAATTATTTCATAAGAATATAATTAATAATG GATCATAATGTTTGTTTGTGTGTTTGTATAGGCAACAAAGGAACTTCGATCAATGGGGGTTGATAGCATGATCGTTGGTG TAACAGCACACTCTGTTGATGATGCCCGTGGCCAAGAATTCAAGAAAGCAGGACTAGATGACTGCTTGGAAAAGCCCTTG ACCATGGCCAAGCTTACTTCGATCATTCACAAGATCAACAACAAGAATTTCACTAATGTTTGAGTTAAACTAGCTACA

Download Genomic Sequence

CDS sequence (LotjaGi1g1v0700700.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGATGCTCGTCAATTAACCGCACTTGTTGTTGATGATGACATCATTGTCCGAATGATATATGGAAAGATGTTGAACAG AGTTGGTGTGAAAAATCAAGTCGTGGAGAATGGGAAAGAAGCTATAGACATTCACTGCTCTGGTCAAAGCTTTGACCTTA TTTTCATGGACAAGGACATGCCTGTTATGAATGGCATTGAGGCAACAAAGGAACTTCGATCAATGGGGGTTGATAGCATG ATCGTTGGTGTAACAGCACACTCTGTTGATGATGCCCGTGGCCAAGAATTCAAGAAAGCAGGACTAGATGACTGCTTGGA AAAGCCCTTGACCATGGCCAAGCTTACTTCGATCATTCACAAGATCAACAACAAGAATTTCACTAATGTTTGA

Download CDS Sequence

Protein sequence (LotjaGi1g1v0700700.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MDARQLTALVVDDDIIVRMIYGKMLNRVGVKNQVVENGKEAIDIHCSGQSFDLIFMDKDMPVMNGIEATKELRSMGVDSM IVGVTAHSVDDARGQEFKKAGLDDCLEKPLTMAKLTSIIHKINNKNFTNV

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
Gene3D	G3DSA:3.40.50.2300 View details on G3DSA:3.40.50.2300 Search for proteins/transripts with this domain View external data on G3DSA:3.40.50.2300	1	129	129	3.5E-33	–
PANTHER	PTHR43228 View details on PTHR43228 Search for proteins/transripts with this domain View external data on PTHR43228	4	125	122	1.2E-49	–
PANTHER	PTHR43228:SF10 View details on PTHR43228:SF10 Search for proteins/transripts with this domain View external data on PTHR43228:SF10	4	125	122	1.2E-49	–
SUPERFAMILY	SSF52172 View details on SSF52172 Search for proteins/transripts with this domain View external data on SSF52172	5	123	119	1.71E-29	IPR011006 Show description in modal box View details on IPR011006 Search for proteins/transripts with this domain View on EBI InterPro Service
SMART	SM00448 View details on SM00448 Search for proteins/transripts with this domain View external data on SM00448	6	119	114	5.3E-23	IPR001789 Show description in modal box View details on IPR001789 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS50110 View details on PS50110 Search for proteins/transripts with this domain View external data on PS50110	7	123	117	35.459	IPR001789 Show description in modal box View details on IPR001789 Search for proteins/transripts with this domain View on EBI InterPro Service
CDD	cd00156 View details on cd00156 Search for proteins/transripts with this domain View external data on cd00156	9	122	114	2.6283E-27	IPR001789 Show description in modal box View details on IPR001789 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF00072 View details on PF00072 Search for proteins/transripts with this domain View external data on PF00072	9	119	111	1.1E-22	IPR001789 Show description in modal box View details on IPR001789 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0000160 View details of GO:0000160 AmiGO InterPro QuickGO	Biological process	Phosphorelay signal transduction system	A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.	Subterm of View details of GO:0035556

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi1g1v0700700.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…