Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0045300.1

Overview

Field	Value
Gene ID	LotjaGi3g1v0045300
Transcript ID	LotjaGi3g1v0045300.1
Lotus japonicus genome version	Gifu v1.2
Description	Ethylene-responsive transcription factor, putative; TAIR: AT3G15210.1 ethylene responsive element binding factor 4; Swiss-Prot: sp\|O80340\|ERF78_ARATH Ethylene-responsive transcription factor 4; TrEMBL-Plants: tr\|A0A072VB55\|A0A072VB55_MEDTR AP2 domain class transcription factor; Found in the gene: LotjaGi3g1v0045300
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr3:4834270..4835112) extracted from Lotus japonicus Gifu genome v1.2.

CTAGCTTAACCTCTTAGTTTCACTCCCCCAAAAGAATGCCTCCAAGAGGGAATCGCACCATTCTCCCTCGACCCAACCTG GCCACAGAGGTCAAGTACAGAGGGGTCAGGAAGAGACCATGGGGTCGTTATGCCGCCGAGATCCGTGATCCAAATCGGAA AATTCGTGTCTGGCTCGGCACATTCGACACTGCAGTGGAAGCAGCGTATGCCTATGACGATGCAGCGCGTGCGTTCCATG GCGATAAGGCCAAGCTCAATTTCCCCATCACGACAGATCTCAATTTTCCCATCCCTACCAACAACAACAACTCTGTCCTG CGCATTCCCAGCCAAGGAAGTACCTTCGAGTTCTCCTCTTCGGCACTGTTGAATCTCACTCTCGCTGTTGTTGATACTAC ACCGATTGTTTCCTCCGTCGCCATTAATGCTAATGCGGCCCCCGCGAGGGTTTTCAGCGTCGCTGCTGGTCACCCTCTAG CATTCTTTAATGACTTGACTCCTGTTGCCGCCGCCACGAGGCAAGGAAGAGATCAAAGTGAATCTGGGTCGTCATCCACC GTGGAGAATGAACAAGTCCTTGTAGGTCCAAATCAGGTCAATTTTGACCTTAACGCCCCACCCCTACCAGATAATGCCTA ATCTTTCTGTTCTCAATTTAAAATTGAGACTAGAGAGTGATCGATGATGCTGATGATGTAATTACAAATAATTAAAATTA GACAAAACATAGGCCTTTGTTTTCTCTGCTGAGGAATTTCATGTTGTTGTCATGGACATCGTTGTTAACAACATGTAAAT GTAATAATGGCCTTTTTATTTTCATATTAACAAAAAACAAAAC

Download Genomic Sequence

CDS sequence (LotjaGi3g1v0045300.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGCCTCCAAGAGGGAATCGCACCATTCTCCCTCGACCCAACCTGGCCACAGAGGTCAAGTACAGAGGGGTCAGGAAGAG ACCATGGGGTCGTTATGCCGCCGAGATCCGTGATCCAAATCGGAAAATTCGTGTCTGGCTCGGCACATTCGACACTGCAG TGGAAGCAGCGTATGCCTATGACGATGCAGCGCGTGCGTTCCATGGCGATAAGGCCAAGCTCAATTTCCCCATCACGACA GATCTCAATTTTCCCATCCCTACCAACAACAACAACTCTGTCCTGCGCATTCCCAGCCAAGGAAGTACCTTCGAGTTCTC CTCTTCGGCACTGTTGAATCTCACTCTCGCTGTTGTTGATACTACACCGATTGTTTCCTCCGTCGCCATTAATGCTAATG CGGCCCCCGCGAGGGTTTTCAGCGTCGCTGCTGGTCACCCTCTAGCATTCTTTAATGACTTGACTCCTGTTGCCGCCGCC ACGAGGCAAGGAAGAGATCAAAGTGAATCTGGGTCGTCATCCACCGTGGAGAATGAACAAGTCCTTGTAGGTCCAAATCA GGTCAATTTTGACCTTAACGCCCCACCCCTACCAGATAATGCCTAA

Download CDS Sequence

Protein sequence (LotjaGi3g1v0045300.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MPPRGNRTILPRPNLATEVKYRGVRKRPWGRYAAEIRDPNRKIRVWLGTFDTAVEAAYAYDDAARAFHGDKAKLNFPITT DLNFPIPTNNNNSVLRIPSQGSTFEFSSSALLNLTLAVVDTTPIVSSVAINANAAPARVFSVAAGHPLAFFNDLTPVAAA TRQGRDQSESGSSSTVENEQVLVGPNQVNFDLNAPPLPDNA

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR31677:SF96 View details on PTHR31677:SF96 Search for proteins/transripts with this domain View external data on PTHR31677:SF96	16	133	118	4.6E-48	–
PANTHER	PTHR31677 View details on PTHR31677 Search for proteins/transripts with this domain View external data on PTHR31677	16	133	118	4.6E-48	–
Gene3D	G3DSA:3.30.730.10 View details on G3DSA:3.30.730.10 Search for proteins/transripts with this domain View external data on G3DSA:3.30.730.10	19	80	62	8.1E-30	IPR036955 Show description in modal box View details on IPR036955 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS51032 View details on PS51032 Search for proteins/transripts with this domain View external data on PS51032	20	77	58	22.603	IPR001471 Show description in modal box View details on IPR001471 Search for proteins/transripts with this domain View on EBI InterPro Service
SMART	SM00380 View details on SM00380 Search for proteins/transripts with this domain View external data on SM00380	20	83	64	8.7E-35	IPR001471 Show description in modal box View details on IPR001471 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF00847 View details on PF00847 Search for proteins/transripts with this domain View external data on PF00847	20	69	50	2.5E-11	IPR001471 Show description in modal box View details on IPR001471 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF54171 View details on SSF54171 Search for proteins/transripts with this domain View external data on SSF54171	20	78	59	1.63E-21	IPR016177 Show description in modal box View details on IPR016177 Search for proteins/transripts with this domain View on EBI InterPro Service
CDD	cd00018 View details on cd00018 Search for proteins/transripts with this domain View external data on cd00018	20	79	60	7.63833E-22	IPR001471 Show description in modal box View details on IPR001471 Search for proteins/transripts with this domain View on EBI InterPro Service
PRINTS	PR00367 View details on PR00367 Search for proteins/transripts with this domain View external data on PR00367	21	32	12	7.7E-10	IPR001471 Show description in modal box View details on IPR001471 Search for proteins/transripts with this domain View on EBI InterPro Service
PRINTS	PR00367 View details on PR00367 Search for proteins/transripts with this domain View external data on PR00367	43	59	17	7.7E-10	IPR001471 Show description in modal box View details on IPR001471 Search for proteins/transripts with this domain View on EBI InterPro Service
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	161	201	41	-	–
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	161	187	27	-	–

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0003677 View details of GO:0003677 AmiGO InterPro QuickGO	Molecular function	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).	Subterm of View details of GO:0003676
GO:0003700 View details of GO:0003700 AmiGO InterPro QuickGO	Molecular function	DNA-binding transcription factor activity	A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within the regulatory region of a gene to modulate transcription. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.	Subterm of View details of GO:0140110
GO:0006355 View details of GO:0006355 AmiGO InterPro QuickGO	Biological process	Regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.	Subterm of View details of GO:0010468 View details of GO:1903506 View details of GO:2000112 Regulates View details of GO:0006351

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0045300.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…