Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0080500.1

Overview

Field	Value
Gene ID	LotjaGi3g1v0080500
Transcript ID	LotjaGi3g1v0080500.1
Lotus japonicus genome version	Gifu v1.2
Description	Calcium-binding family protein; TAIR: AT5G54490.1 pinoid-binding protein 1; Swiss-Prot: sp\|Q9LSQ6\|PBP1_ARATH Calcium-binding protein PBP1; TrEMBL-Plants: tr\|I3SSR8\|I3SSR8_LOTJA Uncharacterized protein; Found in the gene: LotjaGi3g1v0080500
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr3:8925423..8925770) extracted from Lotus japonicus Gifu genome v1.2.

CACCAACAACAAGCTCAGTTCCAAGACCACCTACCTCTCATGGCCAACAAGCTAGGAGGTGATGGCCTAATAGACGAGCT CTGCAACGGGTTTAACCTCTTGATGGATGCAGAAAAAGGGGTCATTACTTTTGATAGTCTCAAGAGGAATGCCCATTTTC TTGGGCTACAGGACCTCAGTGATGAGGATCTTCGTTCCATGATCGTGGAAGGTGATTTTGATCGTGATGGGGCTCTAAGT CAGATGGAGTTTTGTGTCTTGATGTTTAGACTGAGTCCTGAACTCATGGAAAGGTCTCAGATGTGGTTGGAGCAAGTGCT TGAGCAAGAAATGAAAGATTTTTTGTAA

Download Genomic Sequence

CDS sequence (LotjaGi3g1v0080500.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCCAACAAGCTAGGAGGTGATGGCCTAATAGACGAGCTCTGCAACGGGTTTAACCTCTTGATGGATGCAGAAAAAGG GGTCATTACTTTTGATAGTCTCAAGAGGAATGCCCATTTTCTTGGGCTACAGGACCTCAGTGATGAGGATCTTCGTTCCA TGATCGTGGAAGGTGATTTTGATCGTGATGGGGCTCTAAGTCAGATGGAGTTTTGTGTCTTGATGTTTAGACTGAGTCCT GAACTCATGGAAAGGTCTCAGATGTGGTTGGAGCAAGTGCTTGAGCAAGAAATGAAAGATTTTTTGTAA

Download CDS Sequence

Protein sequence (LotjaGi3g1v0080500.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MANKLGGDGLIDELCNGFNLLMDAEKGVITFDSLKRNAHFLGLQDLSDEDLRSMIVEGDFDRDGALSQMEFCVLMFRLSP ELMERSQMWLEQVLEQEMKDFL

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
Gene3D	G3DSA:1.10.238.10 View details on G3DSA:1.10.238.10 Search for proteins/transripts with this domain View external data on G3DSA:1.10.238.10	1	101	101	8.1E-19	–
PANTHER	PTHR47319 View details on PTHR47319 Search for proteins/transripts with this domain View external data on PTHR47319	1	101	101	2.8E-56	–
PANTHER	PTHR47319:SF12 View details on PTHR47319:SF12 Search for proteins/transripts with this domain View external data on PTHR47319:SF12	1	101	101	2.8E-56	–
SUPERFAMILY	SSF47473 View details on SSF47473 Search for proteins/transripts with this domain View external data on SSF47473	11	89	79	5.87E-12	IPR011992 Show description in modal box View details on IPR011992 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF13833 View details on PF13833 Search for proteins/transripts with this domain View external data on PF13833	25	77	53	8.0E-18	–
ProSiteProfiles	PS50222 View details on PS50222 Search for proteins/transripts with this domain View external data on PS50222	46	81	36	9.827	IPR002048 Show description in modal box View details on IPR002048 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSitePatterns	PS00018 View details on PS00018 Search for proteins/transripts with this domain View external data on PS00018	59	71	13	-	IPR018247 Show description in modal box View details on IPR018247 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0005509 View details of GO:0005509 AmiGO InterPro QuickGO	Molecular function	Calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).	Subterm of View details of GO:0046872

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0080500.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…