Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi3g1v0344500 |
Transcript ID | LotjaGi3g1v0344500.1 |
Lotus japonicus genome version | Gifu v1.2 |
Description | ATPase subunit 8; TAIR: AT2G07707.1 Plant mitochondrial ATPase, F0 complex, subunit 8 protein; Swiss-Prot: sp|P41248|YMF19_HELAN Putative ATP synthase protein YMF19; TrEMBL-Plants: tr|A0A110BE97|A0A110BE97_9FABA ATPase subunit 8; Found in the gene: LotjaGi3g1v0344500 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:72186595..72187077) extracted from Lotus japonicus Gifu genome v1.2.
ATGCCTCAACTGGATAAATTCACTTATTTCACACAATTTTTCTGGTCATGCCTTTTCCTCTTTACTTTATGTATTCCCAT ATGCAATGATGGAGATGGAGTACTTGGGATCCGCAGAATTCTAAAACTACGGAACCAACTGGTTTCAAACTGGGGGAACA AAATCCGGAGCAACGACCCCAACAGTTTGGAAGATATCTTTAGAAAAGGTTTTAGCACCGGTTTATCCTATATGTACTCT AGTTTATTCGAAGTATCCCAATGGTGTAACGCCGTCGACTTATTGGGAAAAAGGAGGAAAATAATTTCTCTCTCTTGTTT CGGAGAAATAAATGGGTCACGAGGAATGGGAAGAAACATCTTATATTTTATCTCGAAGTCCTCATATGGCGCTTCTTCTT CAAATCCTGGATGGGTGATCACTTGTAGGAATGACATAATGCTAATCCATGTTCCACACGACCAAGGAAGAATCAAAAAA TAA
CDS sequence (LotjaGi3g1v0344500.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGCCTCAACTGGATAAATTCACTTATTTCACACAATTTTTCTGGTCATGCCTTTTCCTCTTTACTTTATGTATTCCCAT ATGCAATGATGGAGATGGAGTACTTGGGATCCGCAGAATTCTAAAACTACGGAACCAACTGGTTTCAAACTGGGGGAACA AAATCCGGAGCAACGACCCCAACAGTTTGGAAGATATCTTTAGAAAAGGTTTTAGCACCGGTTTATCCTATATGTACTCT AGTTTATTCGAAGTATCCCAATGGTGTAACGCCGTCGACTTATTGGGAAAAAGGAGGAAAATAATTTCTCTCTCTTGTTT CGGAGAAATAAATGGGTCACGAGGAATGGGAAGAAACATCTTATATTTTATCTCGAAGTCCTCATATGGCGCTTCTTCTT CAAATCCTGGATGGGTGATCACTTGTAGGAATGACATAATGCTAATCCATGTTCCACACGACCAAGGAAGAATCAAAAAA TAA
Protein sequence (LotjaGi3g1v0344500.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MPQLDKFTYFTQFFWSCLFLFTLCIPICNDGDGVLGIRRILKLRNQLVSNWGNKIRSNDPNSLEDIFRKGFSTGLSYMYS SLFEVSQWCNAVDLLGKRRKIISLSCFGEINGSRGMGRNILYFISKSSYGASSSNPGWVITCRNDIMLIHVPHDQGRIKK
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 1 | 159 | 159 | 1.3E-77 | – | |
Phobius | 1 | 11 | 11 | - | – | |
Pfam | 2 | 82 | 81 | 1.7E-19 | ||
Phobius | 12 | 29 | 18 | - | – | |
TMHMM | 13 | 35 | 23 | - | – | |
Phobius | 30 | 160 | 131 | - | – | |
Pfam | 93 | 144 | 52 | 2.0E-25 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Cellular component | Mitochondrion | A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration. | ||
Cellular component | Integral component of membrane | The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane. |
Expression pattern of LotjaGi3g1v0344500.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…