Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0502600.1

Overview

Field Value
Gene ID LotjaGi3g1v0502600
Transcript ID LotjaGi3g1v0502600.1
Lotus japonicus genome version Gifu v1.2
Description Diphthamide biosynthesis protein 3; TAIR: AT2G15910.1 CSL zinc finger domain-containing protein; Swiss-Prot: sp|Q6CMG4|DPH3_KLULA Diphthamide biosynthesis protein 3; TrEMBL-Plants: tr|I3SPP6|I3SPP6_LOTJA Uncharacterized protein; Found in the gene: LotjaGi3g1v0502600
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr3:92079242..92079502) extracted from Lotus japonicus Gifu genome v1.2.

ATGTCGTACGACGACGTGGAGATTGAGGACATGGAGTGGAACGAGGAATTGCAGGCGTACACGTACCCGTGTCCTTGCGG GGACCTGTTCCAGATTACAAAGGAGGACCTCAAGCTCGGCGAGGAAATCGCTCGCTGCCCTAGTTGCTCTCTTTACATCA CCGTCATCTACAACATGGAAGACTTCCTCGGCGATTCTGATCAAAATCATAGAAACAAGGGTCTTCAGCCCTCCAAGCAA CAAACTGTCACTATTGCTTGA 

CDS sequence (LotjaGi3g1v0502600.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTCGTACGACGACGTGGAGATTGAGGACATGGAGTGGAACGAGGAATTGCAGGCGTACACGTACCCGTGTCCTTGCGG GGACCTGTTCCAGATTACAAAGGAGGACCTCAAGCTCGGCGAGGAAATCGCTCGCTGCCCTAGTTGCTCTCTTTACATCA CCGTCATCTACAACATGGAAGACTTCCTCGGCGATTCTGATCAAAATCATAGAAACAAGGGTCTTCAGCCCTCCAAGCAA CAAACTGTCACTATTGCTTGA 

Protein sequence (LotjaGi3g1v0502600.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSYDDVEIEDMEWNEELQAYTYPCPCGDLFQITKEDLKLGEEIARCPSCSLYITVIYNMEDFLGDSDQNHRNKGLQPSKQ QTVTIA 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 1 73 73 8.4E-40
PANTHER 1 73 73 8.4E-40
Gene3D 1 85 85 1.0E-31
ProSiteProfiles 2 58 57 23.37
SUPERFAMILY 2 73 72 6.8E-28
Pfam 4 58 55 4.1E-22
MobiDBLite 67 86 20 -
MobiDBLite 69 86 18 -

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

Unable to find any GO terms for the transcript with the identifier.

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0502600.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…