Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi4g1v0009200 |
| Transcript ID | LotjaGi4g1v0009200.2 |
| Related isoforms 1 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Mediator of RNA polymerase II transcription subunit 11; TAIR: AT3G01435.1 Expressed protein; Swiss-Prot: sp|Q6ID77|MED11_ARATH Mediator of RNA polymerase II transcription subunit 11; TrEMBL-Plants: tr|I3RZN2|I3RZN2_LOTJA Uncharacterized protein; Found in the gene: LotjaGi4g1v0009200 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr4:1244413..1245705) extracted from Lotus japonicus Gifu genome v1.2.
ATGGATCCGCAGGGCCAGACAACTTCTTTGCAGCGACTTCAGAATGTGGAAAAGGTAAATTTTCATAGCATTAAGAAGAA GCAATGTTGCTGGCTGTTTGTTCTAATTGATTTTGTTCTTGGTGATGTGCAGAGAATTGTCAAGGTTTTAGAGCTTGCAG GAGGAGTTATGGATGAGCTTGCAAGCCCACTTGGTCCTCGGAAAGATGTGGTCCAAAATCACTGTCTTGAATTCATGCAA TTAATCAAGGTTTTTGTCTCTCAGAAATCAATTTATTATTTTGTCTATCAATGATTTAATGTATGGTAAGAGGGGTTTGT TGTTGTTTAATGTATGGTAAGAGGGTGGCATTATAGGTTTAAGTGCCCGAAAAGGCACACACTACCGAAACTGCACTATT ATAACTTCAAATATTATAGTGGTTCATTTTAGCAGTTAACATAATATAAAGATGAACACCAGGTATTTCATAACAATAAG AAGTTTAGATTCATCTGGTTATAACACCACATATATTACTTGAAACCAACATTTCTCTGAGCTGGATAGAGTCTGAACTG TGATATCCCCATACATAGATGTCTTTCATCACATGATTCCAAACTTATGTCATTAACTGTAAGATCTGACTTTTAACATT TGAAGTTACTTTAGCCATACTGCCATAGTGGCTACTTATGTTCCCTTATAGTGTATATATTTTGTATTGGCTTATGTGAT AAAGACCAACTCCATTCATTTAAAGTTACTTCCTGCTATGTGTGTGTAATTGGTGCAAAGATGCTTTTGTGTGGAATGTA TTTGGAATATTACTTTTAGAAAAATTAGCTGTGTTAGGCAATGCTTGCTAAATTTTAACTAGAATGAGTTTTGTTTCGTT AGAATGGTACTATGACTTAAATTAATTGAATGTGGAGTGGTGTGTTTGTGGCTTTTTGGTGTAACTATAACCCTTTTCCA TTTCTTCCTGACTGTCAGCTAGCTTAGTTTCAGCTAGTGAAATGATGCTGTAAAATTCAGCTAGTGAATAGAACTGTGTA CTTATGATCAATGACCATGTTCTTATTTTGGTTCATCATCATGAATTTGATTTTTCCCCCTTTGTAAATCTTTTAGGACA TCCAGGTGGCGTTGCGTGATGAAATCAAAAGTGCTTGTGAATATCGCCCTTTTGAGAAATGTGATTATGGTTCAAGAATA GCCAATGAGATTTGTTACCAGAAGGTGGAATTTGTCATGTCACAATTGGATGCCATGAAACAAACTATAGATGAGTATCA TGCAGCAGTCTGA
CDS sequence (LotjaGi4g1v0009200.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGATCCGCAGGGCCAGACAACTTCTTTGCAGCGACTTCAGAATGTGGAAAAGAGAATTGTCAAGGTTTTAGAGCTTGC AGGAGGAGTTATGGATGAGCTTGCAAGCCCACTTGGTCCTCGGAAAGATGTGGTCCAAAATCACTGTCTTGAATTCATGC AATTAATCAAGGACATCCAGGTGGCGTTGCGTGATGAAATCAAAAGTGCTTGTGAATATCGCCCTTTTGAGAAATGTGAT TATGGTTCAAGAATAGCCAATGAGATTTGTTACCAGAAGGTGGAATTTGTCATGTCACAATTGGATGCCATGAAACAAAC TATAGATGAGTATCATGCAGCAGTCTGA
Protein sequence (LotjaGi4g1v0009200.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MDPQGQTTSLQRLQNVEKRIVKVLELAGGVMDELASPLGPRKDVVQNHCLEFMQLIKDIQVALRDEIKSACEYRPFEKCD YGSRIANEICYQKVEFVMSQLDAMKQTIDEYHAAV
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| PANTHER | 1 | 115 | 115 | 1.7E-71 | ||
| Pfam | 9 | 107 | 99 | 1.8E-13 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | Transcription coregulator activity | A protein or a member of a complex that interacts specifically and non-covalently with a DNA-bound DNA-binding transcription factor to either activate or repress the transcription of specific genes. Coregulators often act by altering chromatin structure and modifications. For example, one class of transcription coregulators modifies chromatin structure through covalent modification of histones. A second ATP-dependent class modifies the conformation of chromatin. A third class modulates interactions of DNA-binding transcription factor with other transcription coregulators. | ||
| Biological process | Regulation of transcription by RNA polymerase II | Any process that modulates the frequency, rate or extent of transcription mediated by RNA polymerase II. | ||
| Cellular component | Mediator complex | A protein complex that interacts with the carboxy-terminal domain of the largest subunit of RNA polymerase II and plays an active role in transducing the signal from a transcription factor to the transcriptional machinery. The mediator complex is required for activation of transcription of most protein-coding genes, but can also act as a transcriptional corepressor. The Saccharomyces complex contains several identifiable subcomplexes: a head domain comprising Srb2, -4, and -5, Med6, -8, and -11, and Rox3 proteins; a middle domain comprising Med1, -4, and -7, Nut1 and -2, Cse2, Rgr1, Soh1, and Srb7 proteins; a tail consisting of Gal11p, Med2p, Pgd1p, and Sin4p; and a regulatory subcomplex comprising Ssn2, -3, and -8, and Srb8 proteins. Metazoan mediator complexes have similar modular structures and include homologs of yeast Srb and Med proteins. |
Expression pattern of LotjaGi4g1v0009200.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…