Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi4g1v0031800.2

Overview

Field	Value
Gene ID	LotjaGi4g1v0031800
Transcript ID	LotjaGi4g1v0031800.2
Related isoforms 1	LotjaGi4g1v0031800.1
Lotus japonicus genome version	Gifu v1.2
Description	RNA-binding protein; TAIR: AT3G26420.1 RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain-containing protein; Swiss-Prot: sp\|Q9LIN3\|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A; TrEMBL-Plants: tr\|I3SUE0\|I3SUE0_LOTJA Uncharacterized protein; Found in the gene: LotjaGi4g1v0031800
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr4:3929744..3930553) extracted from Lotus japonicus Gifu genome v1.2.

ATGTCAGATGTGGACGAGTATCGCTGTTTTATTGGTGGCCTTGCCTGGTCAACATCTGATAGAAAGTTAAAGGATGCATT TGAAAAGTTTGGCAAGCTTACGGAAGCAAAGGTATCTTATTTCATGTTAGATTACAAGTTGGTTTATCCTGCCTGCACCT TTGGCTTAGATCTAAAATTTATTCTGTTATTTTTTTCATTTTGGAAGGAAAATTGCAGTATATATATACATACTGAGCAT GTTTATTAGCAAACTGTGTAATATGATTAACAATTTCTGAAACAGGTTGTTGTTGACAAGTTCTCTGGACGCTCTCGGGG GTTTGGATTTGTCACATTTGATGACAAGAAAGCAATGGACGAGGCTATTGATGCTATGAATGGGATGGATTTAGATGGGC GTACTATTACTGTTGATAAAGCTCAGCCACAAGGATCATCTAGGGATAGGGATGATGGTGATCGCTACAGAGAGCGTGGT CGTGATCGTGATGATCGTGGCGATCGTGATCGTAGCCGAGGCTATGGAGGTAGTCGTGGATCTAATGGAGGTGAATGCTT TAAGTGTGGTAAGCCTGGTCATTTTGCTAGGGAGTGTCCTAGTGAAGGGGAACGAGGAGGGGGAAGGTATGGTGGCAGGG AAAGTCGAAGCAGTGGCGGTGGCTATGGTCCTGATAGAAATGCAGATCGTTCTTCTGGTGGGCGCAGCAGCAGGGATGGT GGTAGTCATGGAGATTCTGGAAGTGATCGATACCATCGTGATCGTTCTGGACCGTATGAACGAAGGGGATCATCAGGAGG CTATCGTTGA

Download Genomic Sequence

CDS sequence (LotjaGi4g1v0031800.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTCAGATGTGGACGAGTATCGCTGTTTTATTGGTGGCCTTGCCTGGTCAACATCTGATAGAAAGTTAAAGGATGCATT TGAAAAGTTTGGCAAGCTTACGGAAGCAAAGGTTGTTGTTGACAAGTTCTCTGGACGCTCTCGGGGGTTTGGATTTGTCA CATTTGATGACAAGAAAGCAATGGACGAGGCTATTGATGCTATGAATGGGATGGATTTAGATGGGCGTACTATTACTGTT GATAAAGCTCAGCCACAAGGATCATCTAGGGATAGGGATGATGGTGATCGCTACAGAGAGCGTGGTCGTGATCGTGATGA TCGTGGCGATCGTGATCGTAGCCGAGGCTATGGAGGTAGTCGTGGATCTAATGGAGGTGAATGCTTTAAGTGTGGTAAGC CTGGTCATTTTGCTAGGGAGTGTCCTAGTGAAGGGGAACGAGGAGGGGGAAGGTATGGTGGCAGGGAAAGTCGAAGCAGT GGCGGTGGCTATGGTCCTGATAGAAATGCAGATCGTTCTTCTGGTGGGCGCAGCAGCAGGGATGGTGGTAGTCATGGAGA TTCTGGAAGTGATCGATACCATCGTGATCGTTCTGGACCGTATGAACGAAGGGGATCATCAGGAGGCTATCGTTGA

Download CDS Sequence

Protein sequence (LotjaGi4g1v0031800.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSDVDEYRCFIGGLAWSTSDRKLKDAFEKFGKLTEAKVVVDKFSGRSRGFGFVTFDDKKAMDEAIDAMNGMDLDGRTITV DKAQPQGSSRDRDDGDRYRERGRDRDDRGDRDRSRGYGGSRGSNGGECFKCGKPGHFARECPSEGERGGGRYGGRESRSS GGGYGPDRNADRSSGGRSSRDGGSHGDSGSDRYHRDRSGPYERRGSSGGYR

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
Gene3D	G3DSA:3.30.70.330 View details on G3DSA:3.30.70.330 Search for proteins/transripts with this domain View external data on G3DSA:3.30.70.330	1	99	99	1.6E-29	IPR012677 Show description in modal box View details on IPR012677 Search for proteins/transripts with this domain View on EBI InterPro Service
PANTHER	PTHR15241:SF227 View details on PTHR15241:SF227 Search for proteins/transripts with this domain View external data on PTHR15241:SF227	3	156	154	2.1E-70	–
PANTHER	PTHR15241 View details on PTHR15241 Search for proteins/transripts with this domain View external data on PTHR15241	3	156	154	2.1E-70	–
SUPERFAMILY	SSF54928 View details on SSF54928 Search for proteins/transripts with this domain View external data on SSF54928	4	114	111	1.14E-31	IPR035979 Show description in modal box View details on IPR035979 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS50102 View details on PS50102 Search for proteins/transripts with this domain View external data on PS50102	7	85	79	20.218	IPR000504 Show description in modal box View details on IPR000504 Search for proteins/transripts with this domain View on EBI InterPro Service
SMART	SM00360 View details on SM00360 Search for proteins/transripts with this domain View external data on SM00360	8	81	74	4.1E-28	IPR000504 Show description in modal box View details on IPR000504 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF00076 View details on PF00076 Search for proteins/transripts with this domain View external data on PF00076	10	79	70	3.3E-22	IPR000504 Show description in modal box View details on IPR000504 Search for proteins/transripts with this domain View on EBI InterPro Service
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	76	211	136	-	–
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	86	117	32	-	–
SUPERFAMILY	SSF57756 View details on SSF57756 Search for proteins/transripts with this domain View external data on SSF57756	109	147	39	8.64E-10	IPR036875 Show description in modal box View details on IPR036875 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:4.10.60.10 View details on G3DSA:4.10.60.10 Search for proteins/transripts with this domain View external data on G3DSA:4.10.60.10	119	176	58	1.6E-9	–
SMART	SM00343 View details on SM00343 Search for proteins/transripts with this domain View external data on SM00343	127	143	17	2.4E-6	IPR001878 Show description in modal box View details on IPR001878 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF00098 View details on PF00098 Search for proteins/transripts with this domain View external data on PF00098	127	143	17	3.7E-8	IPR001878 Show description in modal box View details on IPR001878 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS50158 View details on PS50158 Search for proteins/transripts with this domain View external data on PS50158	128	143	16	11.565	IPR001878 Show description in modal box View details on IPR001878 Search for proteins/transripts with this domain View on EBI InterPro Service
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	133	153	21	-	–
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	184	202	19	-	–

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0003676 View details of GO:0003676 AmiGO InterPro QuickGO	Molecular function	Nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.	Subterm of View details of GO:0097159 View details of GO:1901363
GO:0008270 View details of GO:0008270 AmiGO InterPro QuickGO	Molecular function	Zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.	Subterm of View details of GO:0046914

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi4g1v0031800.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…