Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi4g1v0056600 |
Transcript ID | LotjaGi4g1v0056600.1 |
Lotus japonicus genome version | Gifu v1.2 |
Description | Lipoxygenase; TAIR: AT1G17420.1 lipoxygenase 3; Swiss-Prot: sp|O24371|LOX31_SOLTU Linoleate 13S-lipoxygenase 3-1, chloroplastic; TrEMBL-Plants: tr|A0A0L9TKT4|A0A0L9TKT4_PHAAN Lipoxygenase; Found in the gene: LotjaGi4g1v0056600 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr4:6781039..6781317) extracted from Lotus japonicus Gifu genome v1.2.
ATGGCTGTGATCAACATAGGTTCAGCACACTCCCCTGATGAGGAATATATAGGAGACAGAAATGACATCTCTTCTTGGTC AGGAGACCCTGAGATCATTGAGGCATTTTGGCAATTTTCAATGGACATGAAAAATATTGAGATGGAGATTGAGAAAAGAA ACACTGATCCAAAACTTAGGAACAGGTGCGGTGTTGGGGTTTCACCGTATGAACAGCTTATGCCAAGCTCAGGATGTGGA GCCACTGGACGAGGGGTGCCAAATAGTGTAACAGCCTAG
CDS sequence (LotjaGi4g1v0056600.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGCTGTGATCAACATAGGTTCAGCACACTCCCCTGATGAGGAATATATAGGAGACAGAAATGACATCTCTTCTTGGTC AGGAGACCCTGAGATCATTGAGGCATTTTGGCAATTTTCAATGGACATGAAAAATATTGAGATGGAGATTGAGAAAAGAA ACACTGATCCAAAACTTAGGAACAGGTGCGGTGTTGGGGTTTCACCGTATGAACAGCTTATGCCAAGCTCAGGATGTGGA GCCACTGGACGAGGGGTGCCAAATAGTGTAACAGCCTAG
Protein sequence (LotjaGi4g1v0056600.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MAVINIGSAHSPDEEYIGDRNDISSWSGDPEIIEAFWQFSMDMKNIEMEIEKRNTDPKLRNRCGVGVSPYEQLMPSSGCG ATGRGVPNSVTA
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
MobiDBLite | 1 | 24 | 24 | - | – | |
Gene3D | 1 | 91 | 91 | 1.8E-24 | – | |
PANTHER | 1 | 91 | 91 | 1.4E-51 | – | |
PANTHER | 1 | 91 | 91 | 1.4E-51 | ||
ProSiteProfiles | 1 | 92 | 92 | 30.601 | ||
Pfam | 1 | 75 | 75 | 5.0E-22 | ||
SUPERFAMILY | 1 | 91 | 91 | 1.83E-21 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from one donor, and two oxygen atoms is incorporated into a donor. | ||
Molecular function | Metal ion binding | Interacting selectively and non-covalently with any metal ion. | ||
Biological process | Oxidation-reduction process | A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons. |
Expression pattern of LotjaGi4g1v0056600.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…