Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi4g1v0279300.2

Overview

Field	Value
Gene ID	LotjaGi4g1v0279300
Transcript ID	LotjaGi4g1v0279300.2
Related isoforms 2	LotjaGi4g1v0279300.1 LotjaGi4g1v0279300.3
Lotus japonicus genome version	Gifu v1.2
Description	Actin-related protein 2/3 complex subunit 3; TAIR: AT1G60430.1 actin-related protein C3; Swiss-Prot: sp\|Q1ECJ7\|ARPC3_ARATH Actin-related protein 2/3 complex subunit 3; TrEMBL-Plants: tr\|I1MU29\|I1MU29_SOYBN Actin-related protein 2/3 complex subunit 3; Found in the gene: LotjaGi4g1v0279300
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr4:64984029..64984704) extracted from Lotus japonicus Gifu genome v1.2.

ATGGTACGACAATTCAACTCATAGTCATTCTAAATTCATAATTTTGTCGAAATTTCAATACCCAACTGAAAATGGTTGTT GTTGATGTTGTTGTTGTTGGAAGGTTTATCACTCTAGCTTTGTGGATGAAGATGGAGTGAACAAAGCTTGTGGGTGCCCT CTTCTTCCTCTCAAGAGCCATATCAAGGGTCCTGCTCCAGTTTCAGATCAAGGTTTCAATTCCCAGCTGAAAATGGTTGT TGTTGATGTTTTTGTTCTGTGTTTTCAGAATCTGAGATTTACTGTGATGTGTGTTGGTGTTGCAGATAGAACTGATATTG TGGATGAAGCTATCACATTCTTCAGAGCCAATGTGTTCTTCAGAAACTTTGATATCAAGAGCCCTGCTGATAAGCTTCTC ATATACTTGACTTTTTACATCAATGTTGCTCTCAAGAGGCTTGAAGGTCGCAGAACTTTGGCTGAAGGAACCAAGGCAAT CATCAACTTGGGTCTTGAAAAAGTTCCTGTTCCTGGAGAATCTGGTTTTCCTTTTCCGGGGCTTTTCCCACTTCCTCAAT CTCATAAGGAAGCAGGTGAAATACTGTGATCACTTTTGCTTTAGCTTGGTGCTTTTTTTATCGTCTTATGTGTAGCAGAT GCATATGCTTAGTGTTTGTTTGATTACGCGTTGTGA

Download Genomic Sequence

CDS sequence (LotjaGi4g1v0279300.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGTTTATCACTCTAGCTTTGTGGATGAAGATGGAGTGAACAAAGCTTGTGGGTGCCCTCTTCTTCCTCTCAAGAGCCA TATCAAGGGTCCTGCTCCAGTTTCAGATCAAGATAGAACTGATATTGTGGATGAAGCTATCACATTCTTCAGAGCCAATG TGTTCTTCAGAAACTTTGATATCAAGAGCCCTGCTGATAAGCTTCTCATATACTTGACTTTTTACATCAATGTTGCTCTC AAGAGGCTTGAAGGTCGCAGAACTTTGGCTGAAGGAACCAAGGCAATCATCAACTTGGGTCTTGAAAAAGTTCCTGTTCC TGGAGAATCTGGTTTTCCTTTTCCGGGGCTTTTCCCACTTCCTCAATCTCATAAGGAAGCAGATGCATATGCTTAG

Download CDS Sequence

Protein sequence (LotjaGi4g1v0279300.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MVYHSSFVDEDGVNKACGCPLLPLKSHIKGPAPVSDQDRTDIVDEAITFFRANVFFRNFDIKSPADKLLIYLTFYINVAL KRLEGRRTLAEGTKAIINLGLEKVPVPGESGFPFPGLFPLPQSHKEADAYA

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PIRSF	PIRSF016315 View details on PIRSF016315 Search for proteins/transripts with this domain View external data on PIRSF016315	1	131	131	1.6E-47	IPR007204 Show description in modal box View details on IPR007204 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:1.10.1760.10 View details on G3DSA:1.10.1760.10 Search for proteins/transripts with this domain View external data on G3DSA:1.10.1760.10	1	131	131	7.2E-45	IPR036753 Show description in modal box View details on IPR036753 Search for proteins/transripts with this domain View on EBI InterPro Service
PANTHER	PTHR12391:SF0 View details on PTHR12391:SF0 Search for proteins/transripts with this domain View external data on PTHR12391:SF0	2	129	128	1.9E-67	–
Pfam	PF04062 View details on PF04062 Search for proteins/transripts with this domain View external data on PF04062	2	129	128	7.0E-44	IPR007204 Show description in modal box View details on IPR007204 Search for proteins/transripts with this domain View on EBI InterPro Service
PANTHER	PTHR12391 View details on PTHR12391 Search for proteins/transripts with this domain View external data on PTHR12391	2	129	128	1.9E-67	IPR007204 Show description in modal box View details on IPR007204 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF69060 View details on SSF69060 Search for proteins/transripts with this domain View external data on SSF69060	2	129	128	3.4E-45	IPR036753 Show description in modal box View details on IPR036753 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0005856 View details of GO:0005856 AmiGO InterPro QuickGO	Cellular component	Cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.	Subterm of View details of GO:0043232
GO:0005885 View details of GO:0005885 AmiGO InterPro QuickGO	Cellular component	Arp2/3 protein complex	A stable protein complex that contains two actin-related proteins, Arp2 and Arp3, and five novel proteins (ARPC1-5), and functions in the nucleation of branched actin filaments.	Subterm of View details of GO:0032991 View details of GO:0044430 Part of View details of GO:0015629
GO:0030833 View details of GO:0030833 AmiGO InterPro QuickGO	Biological process	Regulation of actin filament polymerization	Any process that modulates the frequency, rate or extent of the assembly of actin filaments by the addition of actin monomers to a filament.	Subterm of View details of GO:0008064 View details of GO:0032271 Regulates View details of GO:0030041
GO:0034314 View details of GO:0034314 AmiGO InterPro QuickGO	Biological process	Arp2/3 complex-mediated actin nucleation	The actin nucleation process in which actin monomers combine to form a new branch on the side of an existing actin filament; mediated by the Arp2/3 protein complex and its interaction with other proteins.	Subterm of View details of GO:0045010

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi4g1v0279300.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…