Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi4g1v0279300 |
Transcript ID | LotjaGi4g1v0279300.3 |
Related isoforms 2 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Actin-related protein 2/3 complex subunit 3; TAIR: AT1G60430.4 actin-related protein C3; Swiss-Prot: sp|Q1ECJ7|ARPC3_ARATH Actin-related protein 2/3 complex subunit 3; TrEMBL-Plants: tr|A0A0B2SS74|A0A0B2SS74_GLYSO Actin-related protein 2/3 complex subunit 3; Found in the gene: LotjaGi4g1v0279300 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr4:64984042..64984704) extracted from Lotus japonicus Gifu genome v1.2.
ATGGTACGACAATTCAACTCATAGTCATTCTAAATTCATAATTTTGTCGAAATTTCAATACCCAACTGAAAATGGTTGTT GTTGATGTTGTTGTTGTTGGAAGGTTTATCACTCTAGCTTTGTGGATGAAGATGGAGTGAACAAAGCTTGTGGGTGCCCT CTTCTTCCTCTCAAGAGCCATATCAAGGGTCCTGCTCCAGTTTCAGATCAAGGTTTCAATTCCCAGCTGAAAATGGTTGT TGTTGATGTTTTTGTTCTGTGTTTTCAGAATCTGAGATTTACTGTGATGTGTGTTGGTGTTGCAGATAGAACTGATATTG TGGATGAAGCTATCACATTCTTCAGAGCCAATGTGTTCTTCAGAAACTTTGATATCAAGAGCCCTGCTGATAAGCTTCTC ATATACTTGACTTTTTACATCAATGTTGCTCTCAAGAGGCTTGAAGGTCGCAGAACTTTGGCTGAAGGAACCAAGGCAAT CATCAACTTGGGTCTTGAAAAAGTTCCTGTTCCTGGAGAATCTGGTTTTCCTTTTCCGGGGCTTTTCCCACTTCCTCAAT CTCATAAGGAAGCAGGTGAAATACTGTGATCACTTTTGCTTTAGCTTGGTGCTTTTTTTATCGTCTTATGTGTAGCAGAT GCATATGCTTAGTGTTTGTTTGA
CDS sequence (LotjaGi4g1v0279300.3) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGTTTATCACTCTAGCTTTGTGGATGAAGATGGAGTGAACAAAGCTTGTGGGTGCCCTCTTCTTCCTCTCAAGAGCCA TATCAAGGGTCCTGCTCCAGTTTCAGATCAAGATAGAACTGATATTGTGGATGAAGCTATCACATTCTTCAGAGCCAATG TGTTCTTCAGAAACTTTGATATCAAGAGCCCTGCTGATAAGCTTCTCATATACTTGACTTTTTACATCAATGTTGCTCTC AAGAGGCTTGAAGGTCGCAGAACTTTGGCTGAAGGAACCAAGGCAATCATCAACTTGGGTCTTGAAAAAGTTCCTGTTCC TGGAGAATCTGGTTTTCCTTTTCCGGGGCTTTTCCCACTTCCTCAATCTCATAAGGAAGCAGGTGAAATACTATGCATAT GCTTAGTGTTTGTTTGA
Protein sequence (LotjaGi4g1v0279300.3) extracted from Lotus japonicus Gifu v1.2 Proteins.
MVYHSSFVDEDGVNKACGCPLLPLKSHIKGPAPVSDQDRTDIVDEAITFFRANVFFRNFDIKSPADKLLIYLTFYINVAL KRLEGRRTLAEGTKAIINLGLEKVPVPGESGFPFPGLFPLPQSHKEAGEILCICLVFV
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PIRSF | 1 | 135 | 135 | 4.1E-47 | ||
Gene3D | 1 | 132 | 132 | 2.0E-44 | ||
PANTHER | 2 | 128 | 127 | 4.6E-67 | – | |
Pfam | 2 | 128 | 127 | 3.0E-43 | ||
PANTHER | 2 | 128 | 127 | 4.6E-67 | ||
SUPERFAMILY | 2 | 127 | 126 | 1.57E-44 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Cellular component | Cytoskeleton | Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles. | ||
Cellular component | Arp2/3 protein complex | A stable protein complex that contains two actin-related proteins, Arp2 and Arp3, and five novel proteins (ARPC1-5), and functions in the nucleation of branched actin filaments. | ||
Biological process | Regulation of actin filament polymerization | Any process that modulates the frequency, rate or extent of the assembly of actin filaments by the addition of actin monomers to a filament. | ||
Biological process | Arp2/3 complex-mediated actin nucleation | The actin nucleation process in which actin monomers combine to form a new branch on the side of an existing actin filament; mediated by the Arp2/3 protein complex and its interaction with other proteins. |
Expression pattern of LotjaGi4g1v0279300.3, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…