Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi4g1v0336400.1

Overview

Field	Value
Gene ID	LotjaGi4g1v0336400
Transcript ID	LotjaGi4g1v0336400.1
Lotus japonicus genome version	Gifu v1.2
Description	GATA transcription factor, putative; TAIR: AT3G06740.1 GATA transcription factor 15; Swiss-Prot: sp\|Q8LG10\|GAT15_ARATH GATA transcription factor 15; TrEMBL-Plants: tr\|I3T122\|I3T122_LOTJA Uncharacterized protein; Found in the gene: LotjaGi4g1v0336400
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr4:71680277..71681502) extracted from Lotus japonicus Gifu genome v1.2.

GTTAATAATGAATAAGTGGTTGTTAGAGAGAAGTGGCGCGTTTTTGTTGATTTTTGGAGATTTTGGCGGGTGATGATGGA ATTGGAAAGGGTAGGAAGGGGTAAAATAGTAATTTAATAAAGTAGTGATTTAGGGTTTTGGTGTCCCATTTATAAAGGTC TGGTGTTTTTGAGCATTAGATCTGCTACTGCGGCCGGTGCGCGTGTGTTGTTGTTTCCTTCGTGTCGTTTCGATTCTCTC TTCACTTTCTCTCTCTAGTTTCTCTCTCTACCTTCACTCTCACTCACTCTGCAAATTTTCCAAAATCTAGCTACCATTAC CTTCAATTTGATCTCAAAAATGGTGGATCCGACTGGAAAAGTGAGTGATTCACCTTCTTGTTACCTCTCCAATCTGGTTT CTGTAGAGTGTTTTAGCTGATCGAGTTTTTTTTTGTTTTGTTTCAGGGATCAGATGCGGAAGACGGAAACCCTAACTCCG CCGCCGCCGCCGCTTCTTCCGGTAGCGAGCAGAAGAAAACCTGCGCCGATTGCGGCACCTCCAAGACTCCTCTCTGGAGA GGTGGACCTGCAGGACCCAAGGTAATGGTGATGATGATCATGATCATGCTTGATCGATCAATTTGATTTGATTTGAGTCT GATCTGATTCTGATTTGGTTGAATGTTTGATTTCTGTGCAGTCGCTATGCAATGCTTGCGGGATCAGGAGCAGGAAGAAG AAGAGAGCGATTTTGGGGATAAGCAAAGGGAACAGCAACAACAATAACAGCAACAATGAAGATGGAATCAAGAAGGGGAA ACGGAGCAAACTAGGCGGCGATCGCTCGAGCTTGAAGCAGAAGCTATTGGCGTTAGGGAGGGAGGTTTTGATGCAGCGAT CGCATTGGAAGAAATTGGGGGAAGAAGAACAAGCTGCAGTGCTTTTAATGTCACTCTCTTATGGATCAGTTTATGCTTAA CATTATCAACAATAACAAGAGGCTAGAACAATTAGAATTTGTTTCATCCAATCCAATCTAGCAGTAACCCTTTTCTTTTC TAAGTGTATATTTGTTAGCTTTTTTTCTTCTACTACTACTGATTGTTGCTATGGGAAGAAGTGAGTGAGTGAGTGTGTTG TAAGAAATCATTCAAATTTCTAAGTCCAATTTTGGTAATATAGTTCTCTCTATTTCTCATTGTTACTAGCAAATCTAATT GAATCAATCCTCCACAACATTCTCAA

Download Genomic Sequence

CDS sequence (LotjaGi4g1v0336400.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGTGGATCCGACTGGAAAAGGATCAGATGCGGAAGACGGAAACCCTAACTCCGCCGCCGCCGCCGCTTCTTCCGGTAG CGAGCAGAAGAAAACCTGCGCCGATTGCGGCACCTCCAAGACTCCTCTCTGGAGAGGTGGACCTGCAGGACCCAAGTCGC TATGCAATGCTTGCGGGATCAGGAGCAGGAAGAAGAAGAGAGCGATTTTGGGGATAAGCAAAGGGAACAGCAACAACAAT AACAGCAACAATGAAGATGGAATCAAGAAGGGGAAACGGAGCAAACTAGGCGGCGATCGCTCGAGCTTGAAGCAGAAGCT ATTGGCGTTAGGGAGGGAGGTTTTGATGCAGCGATCGCATTGGAAGAAATTGGGGGAAGAAGAACAAGCTGCAGTGCTTT TAATGTCACTCTCTTATGGATCAGTTTATGCTTAA

Download CDS Sequence

Protein sequence (LotjaGi4g1v0336400.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MVDPTGKGSDAEDGNPNSAAAAASSGSEQKKTCADCGTSKTPLWRGGPAGPKSLCNACGIRSRKKKRAILGISKGNSNNN NSNNEDGIKKGKRSKLGGDRSSLKQKLLALGREVLMQRSHWKKLGEEEQAAVLLMSLSYGSVYA

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	1	56	56	-	–
PANTHER	PTHR47172 View details on PTHR47172 Search for proteins/transripts with this domain View external data on PTHR47172	5	144	140	9.2E-48	–
PANTHER	PTHR47172:SF1 View details on PTHR47172:SF1 Search for proteins/transripts with this domain View external data on PTHR47172:SF1	5	144	140	9.2E-48	–
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	18	36	19	-	–
Gene3D	G3DSA:3.30.50.10 View details on G3DSA:3.30.50.10 Search for proteins/transripts with this domain View external data on G3DSA:3.30.50.10	26	71	46	1.9E-13	IPR013088 Show description in modal box View details on IPR013088 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS50114 View details on PS50114 Search for proteins/transripts with this domain View external data on PS50114	27	63	37	12.44	IPR000679 Show description in modal box View details on IPR000679 Search for proteins/transripts with this domain View on EBI InterPro Service
SMART	SM00401 View details on SM00401 Search for proteins/transripts with this domain View external data on SM00401	27	78	52	1.2E-12	IPR000679 Show description in modal box View details on IPR000679 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF57716 View details on SSF57716 Search for proteins/transripts with this domain View external data on SSF57716	28	68	41	8.08E-13	–
CDD	cd00202 View details on cd00202 Search for proteins/transripts with this domain View external data on cd00202	32	67	36	1.01762E-12	IPR000679 Show description in modal box View details on IPR000679 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF00320 View details on PF00320 Search for proteins/transripts with this domain View external data on PF00320	33	67	35	1.5E-16	IPR000679 Show description in modal box View details on IPR000679 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSitePatterns	PS00344 View details on PS00344 Search for proteins/transripts with this domain View external data on PS00344	33	58	26	-	IPR000679 Show description in modal box View details on IPR000679 Search for proteins/transripts with this domain View on EBI InterPro Service
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	70	101	32	-	–
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	86	100	15	-	–

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0006355 View details of GO:0006355 AmiGO InterPro QuickGO	Biological process	Regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.	Subterm of View details of GO:0010468 View details of GO:1903506 View details of GO:2000112 Regulates View details of GO:0006351
GO:0008270 View details of GO:0008270 AmiGO InterPro QuickGO	Molecular function	Zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.	Subterm of View details of GO:0046914
GO:0043565 View details of GO:0043565 AmiGO InterPro QuickGO	Molecular function	Sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.	Subterm of View details of GO:0003677

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi4g1v0336400.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…