Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi5g1v0103000 |
Transcript ID | LotjaGi5g1v0103000.2 |
Related isoforms 2 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Prefoldin subunit; TAIR: AT1G29990.1 prefoldin 6; Swiss-Prot: sp|Q17Q89|PFD6_BOVIN Prefoldin subunit 6; TrEMBL-Plants: tr|I3SKF9|I3SKF9_LOTJA Uncharacterized protein; Found in the gene: LotjaGi5g1v0103000 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr5:18733226..18733731) extracted from Lotus japonicus Gifu genome v1.2.
AATACAATGAGTTCGTCCAACATTAGAGATCTTCAACGCGAATTGGAGAACAAAGCCAACGATCTCAGCAAACTTCAAAA GGGCAAGTTTCCTCCTATTCTAGTCCAACCCACCTCCCCCCTTACAAATTTGTATTCATTTATACCTTCCTAATTCCTTC GGCAAATCATTCTGCAGATATTGCGAAGAATCACCAAGTGAGAAAGAAGTACACGGTCCAACTTGGCGAGAACGAGCTCG TCCTTAAGGTACCCTTTTTTTTTTGTCTTTGCGGGAAAACCTTTTCTTTTTTAGTTGTAATTGTTATCCTTCTTTTGGGT CCTTCTGCTTTGGGCGCATTTCTCTGACTGTTATTTCTTTCTCTTTTTCTTTTAAAGGAACTGGATTTATTGAAAGAAGA CGCAAATGTTTACAAGTTGATTGGCCCAGTACTTGTTAAGCAAGATTTGGCTGAGGCCAATGCAAATGTCCGCAAAAGAA TTGAATACATCTCTGCTGAACTGTAA
CDS sequence (LotjaGi5g1v0103000.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGAGTTCGTCCAACATTAGAGATCTTCAACGCGAATTGGAGAACAAAGCCAACGATCTCAGCAAACTTCAAAAGGATAT TGCGAAGAATCACCAAGTGAGAAAGAAGTACACGGTCCAACTTGGCGAGAACGAGCTCGTCCTTAAGGAACTGGATTTAT TGAAAGAAGACGCAAATGTTTACAAGTTGATTGGCCCAGTACTTGTTAAGCAAGATTTGGCTGAGGCCAATGCAAATGTC CGCAAAAGAATTGAATACATCTCTGCTGAACTGTAA
Protein sequence (LotjaGi5g1v0103000.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MSSSNIRDLQRELENKANDLSKLQKDIAKNHQVRKKYTVQLGENELVLKELDLLKEDANVYKLIGPVLVKQDLAEANANV RKRIEYISAEL
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 3 | 91 | 89 | 7.9E-43 | – | |
Coils | 6 | 26 | 21 | - | – | |
Gene3D | 6 | 91 | 86 | 4.9E-28 | ||
SUPERFAMILY | 12 | 90 | 79 | 1.62E-21 | – | |
Pfam | 15 | 91 | 77 | 3.3E-19 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Biological process | Protein folding | The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure. | ||
Cellular component | Prefoldin complex | A multisubunit chaperone that is capable of delivering unfolded proteins to cytosolic chaperonin, which it acts as a cofactor for. In humans, the complex is a heterohexamer of two PFD-alpha and four PFD-beta type subunits. In Saccharomyces cerevisiae, it also acts in the nucleus to regulate the rate of elongation by RNA polymerase II via a direct effect on histone dynamics. | ||
Molecular function | Unfolded protein binding | Interacting selectively and non-covalently with an unfolded protein. |
Expression pattern of LotjaGi5g1v0103000.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…