Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi5g1v0103000.2

Overview

Field Value
Gene ID LotjaGi5g1v0103000
Transcript ID LotjaGi5g1v0103000.2
Related isoforms 2
Lotus japonicus genome version Gifu v1.2
Description Prefoldin subunit; TAIR: AT1G29990.1 prefoldin 6; Swiss-Prot: sp|Q17Q89|PFD6_BOVIN Prefoldin subunit 6; TrEMBL-Plants: tr|I3SKF9|I3SKF9_LOTJA Uncharacterized protein; Found in the gene: LotjaGi5g1v0103000
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr5:18733226..18733731) extracted from Lotus japonicus Gifu genome v1.2.

AATACAATGAGTTCGTCCAACATTAGAGATCTTCAACGCGAATTGGAGAACAAAGCCAACGATCTCAGCAAACTTCAAAA GGGCAAGTTTCCTCCTATTCTAGTCCAACCCACCTCCCCCCTTACAAATTTGTATTCATTTATACCTTCCTAATTCCTTC GGCAAATCATTCTGCAGATATTGCGAAGAATCACCAAGTGAGAAAGAAGTACACGGTCCAACTTGGCGAGAACGAGCTCG TCCTTAAGGTACCCTTTTTTTTTTGTCTTTGCGGGAAAACCTTTTCTTTTTTAGTTGTAATTGTTATCCTTCTTTTGGGT CCTTCTGCTTTGGGCGCATTTCTCTGACTGTTATTTCTTTCTCTTTTTCTTTTAAAGGAACTGGATTTATTGAAAGAAGA CGCAAATGTTTACAAGTTGATTGGCCCAGTACTTGTTAAGCAAGATTTGGCTGAGGCCAATGCAAATGTCCGCAAAAGAA TTGAATACATCTCTGCTGAACTGTAA 

CDS sequence (LotjaGi5g1v0103000.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGAGTTCGTCCAACATTAGAGATCTTCAACGCGAATTGGAGAACAAAGCCAACGATCTCAGCAAACTTCAAAAGGATAT TGCGAAGAATCACCAAGTGAGAAAGAAGTACACGGTCCAACTTGGCGAGAACGAGCTCGTCCTTAAGGAACTGGATTTAT TGAAAGAAGACGCAAATGTTTACAAGTTGATTGGCCCAGTACTTGTTAAGCAAGATTTGGCTGAGGCCAATGCAAATGTC CGCAAAAGAATTGAATACATCTCTGCTGAACTGTAA 

Protein sequence (LotjaGi5g1v0103000.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSSSNIRDLQRELENKANDLSKLQKDIAKNHQVRKKYTVQLGENELVLKELDLLKEDANVYKLIGPVLVKQDLAEANANV RKRIEYISAEL 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 3 91 89 7.9E-43
Coils 6 26 21 -
Gene3D 6 91 86 4.9E-28
SUPERFAMILY 12 90 79 1.62E-21
Pfam 15 91 77 3.3E-19

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Biological process Protein folding The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
Cellular component Prefoldin complex A multisubunit chaperone that is capable of delivering unfolded proteins to cytosolic chaperonin, which it acts as a cofactor for. In humans, the complex is a heterohexamer of two PFD-alpha and four PFD-beta type subunits. In Saccharomyces cerevisiae, it also acts in the nucleus to regulate the rate of elongation by RNA polymerase II via a direct effect on histone dynamics.
Molecular function Unfolded protein binding Interacting selectively and non-covalently with an unfolded protein.

Expression data

Expression pattern

Expression pattern of LotjaGi5g1v0103000.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…