Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi5g1v0284900.3

Overview

Field	Value
Gene ID	LotjaGi5g1v0284900
Transcript ID	LotjaGi5g1v0284900.3
Related isoforms 2	LotjaGi5g1v0284900.1 LotjaGi5g1v0284900.2
Lotus japonicus genome version	Gifu v1.2
Description	F-actin capping protein beta subunit; TAIR: AT1G71790.1 Subunits of heterodimeric actin filament capping protein Capz superfamily; Swiss-Prot: sp\|Q9M9G7\|CAPZB_ARATH Probable F-actin-capping protein subunit beta; TrEMBL-Plants: tr\|I3T7I6\|I3T7I6_LOTJA Uncharacterized protein; Found in the gene: LotjaGi5g1v0284900
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr5:60136745..60137589) extracted from Lotus japonicus Gifu genome v1.2.

ATGTGGGAAGATGACAATGAAGGTTTTGTAGCGTGCTTTTTAATAAAGAAAGGTAAACCTGCTGTCTGAGTATAATGGGA AAAAACTTCCATCCCTTTAACCTTTCCTGCTGATGTGCCATTGTTTCCAATTTTGTGGTTATAGATGGCTCAAAGACAGG GCAAGGTCGACGCGGATATCTAGAGGAAGGAGCATGGGATGCTATACATGTCATAGAGGTAAAGTGTCTTTACATTGAGT TGAAGACTAAGCACTGATAAATGCTGTGTCATACTCATAATGACTTTTAATCCTTTGGAAAAATATAACACTAGTTTATA TTTTTCAGACTCTTTCCTTGATGGTTAATTTTAAAATAAAATTTATATAGGTGGGACCAGAGGAAGAGGAAAACACCAAT TATCGTTTAACCAGTACAGTTATGCTGACTTTGACTACAAGTAATGAGTCATCAGGAACTTTCAGTTTGTCTGGATCAAT TAGACGTCAGGTATTTTCTATTAGAATTTGGTCATGTTGACAATTAGATCTTCTGGTTAACAATTGTATACAAAGTTTGA TTGCTTTCTGTCTCAAGAAGTCACCTGATGAACAATGCACCTTTATTAAATATTCAATCATATGGTTGTTGCTTGATGAA GCCACATAGATTGCATCAGACTTCGTAATTTCTGTAAGCTCTTTTTGTCATCCTAAATTATTTATTGCTTATACTTCAGA TGAATATGAAGCTATCAGTTGCTGATGGACATCTTTGTAACATGGGAAGAATGATTGAAGAAATGGAGAGTAAGCTGAGG AACTCACTTGATCAGGTACCTCTTGATATTGGATTCAAGCTTTAA

Download Genomic Sequence

CDS sequence (LotjaGi5g1v0284900.3) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTGGGAAGATGACAATGAAGGTTTTGTAGCGTGCTTTTTAATAAAGAAAGATGGCTCAAAGACAGGGCAAGGTCGACG CGGATATCTAGAGGAAGGAGCATGGGATGCTATACATGTCATAGAGGTGGGACCAGAGGAAGAGGAAAACACCAATTATC GTTTAACCAGTACAGTTATGCTGACTTTGACTACAAGTAATGAGTCATCAGGAACTTTCAGTTTGTCTGGATCAATTAGA CGTCAGATGAATATGAAGCTATCAGTTGCTGATGGACATCTTTGTAACATGGGAAGAATGATTGAAGAAATGGAGAGTAA GCTGAGGAACTCACTTGATCAGGTACCTCTTGATATTGGATTCAAGCTTTAA

Download CDS Sequence

Protein sequence (LotjaGi5g1v0284900.3) extracted from Lotus japonicus Gifu v1.2 Proteins.

MWEDDNEGFVACFLIKKDGSKTGQGRRGYLEEGAWDAIHVIEVGPEEEENTNYRLTSTVMLTLTTSNESSGTFSLSGSIR RQMNMKLSVADGHLCNMGRMIEEMESKLRNSLDQVPLDIGFKL

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR10619:SF0 View details on PTHR10619:SF0 Search for proteins/transripts with this domain View external data on PTHR10619:SF0	1	115	115	1.2E-42	–
Pfam	PF01115 View details on PF01115 Search for proteins/transripts with this domain View external data on PF01115	1	115	115	9.4E-32	IPR001698 Show description in modal box View details on IPR001698 Search for proteins/transripts with this domain View on EBI InterPro Service
PANTHER	PTHR10619 View details on PTHR10619 Search for proteins/transripts with this domain View external data on PTHR10619	1	115	115	1.2E-42	IPR001698 Show description in modal box View details on IPR001698 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:2.40.160.80 View details on G3DSA:2.40.160.80 Search for proteins/transripts with this domain View external data on G3DSA:2.40.160.80	1	118	118	2.3E-35	IPR042276 Show description in modal box View details on IPR042276 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF90096 View details on SSF90096 Search for proteins/transripts with this domain View external data on SSF90096	4	115	112	2.62E-21	IPR037282 Show description in modal box View details on IPR037282 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0008290 View details of GO:0008290 AmiGO InterPro QuickGO	Cellular component	F-actin capping protein complex	A heterodimer consisting of alpha and beta subunits that binds to and caps the barbed ends of actin filaments, thereby regulating the polymerization of actin monomers but not severing actin filaments.	Subterm of View details of GO:0032991 View details of GO:0044430 Part of View details of GO:0015629
GO:0051016 View details of GO:0051016 AmiGO InterPro QuickGO	Biological process	Barbed-end actin filament capping	The binding of a protein or protein complex to the barbed (or plus) end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.	Subterm of View details of GO:0051693

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi5g1v0284900.3, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…