Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi5g1v0285600.1

Overview

Field	Value
Gene ID	LotjaGi5g1v0285600
Transcript ID	LotjaGi5g1v0285600.1
Lotus japonicus genome version	Gifu v1.2
Description	F-box family protein; TAIR: AT1G51320.1 F-box and associated interaction domains-containing protein; Swiss-Prot: sp\|Q9SYD4\|FBX11_ARATH Putative F-box only protein 11; TrEMBL-Plants: tr\|A0A151RN22\|A0A151RN22_CAJCA F-box/kelch-repeat protein family; Found in the gene: LotjaGi5g1v0285600
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr5:60207724..60209016) extracted from Lotus japonicus Gifu genome v1.2.

GTTTGAAATCACCACCGTCCTTATGTCACCAAGTCTGTCGCGGTTGCCGGTCTTACCGGACGAACTCATCTATGAGATCT TAGTGAAGCTTCCGGTGAAATCCCTTTTGCAATTTAGGTGCGTGTGTAAATTATGGAAAACTCTAATCTCTCATACCCAA TTTGTCAATGACCACCTTCATGCCTCAAATACAATCATGAACCACAAGCGGTTGGTCTTAGTTTACGATTATTCAACCAA GGCCACAACATATTCTATGAATTCATTCTTTCAAAACCCACCAACCCTTACTGAAAAACTGACCTTCAAGATTGGAGGCA AGCACATTTTTATAGGTTCACTCAATGGATTGATGTTTGCGTGATTATAATGGTTGTTTTAGATTGTGTAACCCTGCTAT CAGATTGGAGTCTAAAAGATCGCCGCCCACTCTTTTTCCCGAAAATCTTATGTTCTATTATGACGTTTTTTTTGGATATG ATAAAGCGAACAACAAGTACAAGGTGCTAGTATTTGGGGTCGATGGTGGTAAAATCGTGGCCAAACTTTATACCTTTGGT GAAAGTTATTGGAAAACGATTCAGGATCTCCCATGTCCTGCTAATGCTAAGTGTATGACATATGTGAGTGTGAATGGCAA TCTGCATTGGTTGAATGATTTTAGTAAACCAGTGATTATTTCCTTTGATGTGGAAAAAGAGACTTATGGTGAAATACTGC TACCTCCTCAATTTAATAAACTGGAATGTCACGAGAATAACTATTGGCTTGAGCTGTATGTCTTCAATAATTATCTCTAT GTGTGTCAACTCTTTTACTATAAAACTTCTCGTTTAGTTTTATGGGTGATGAAAGAGTATGGAGTTCAAGAGTCTTGGAC TAAATTGATGACAAATTGACAATTCCTTACAATTTTCATTTTTCCAGATCCCATATTTCTAGATGTTATTACAAGAAAGA CTTTCCTGATTTTAGACCCTTGTGCATTTTGGAAAATGGTGTTGTTCTTCTTACAGCTACATGTTCCCATTCCTACTTAG TTGCCTATGACTCAAATAATGGCAAATTTAGACGTTGTTGTAGGATTACGCGAAGTTCACCAATGATATGGCGCGGAGGA ATTTATCATGAGAGTTTAGTCTCACCACCATGATATGTTGCATTTGTACAGAGCTTTCCAAGCTCTACATATAACTTTAT TATCATAGATTACATAGTTTGAGTTGTTTTGGTGAAATCTCTTCTTCGAATTCTTTGCTTATATCTCTTTATCTTGTATT ATTGATATGGTTG

Download Genomic Sequence

CDS sequence (LotjaGi5g1v0285600.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTCACCAAGTCTGTCGCGGTTGCCGGTCTTACCGGACGAACTCATCTATGAGATCTTAGTGAAGCTTCCGGTGAAATC CCTTTTGCAATTTAGGTGCGTGTGTAAATTATGGAAAACTCTAATCTCTCATACCCAATTTGTCAATGACCACCTTCATG CCTCAAATACAATCATGAACCACAAGCGGTTGGTCTTAGTTTACGATTATTCAACCAAGGCCACAACATATTCTATGAAT TCATTCTTTCAAAACCCACCAACCCTTACTGAAAAACTGACCTTCAAGATTGGAGGCAAGCACATTTTTATAGGTTCACT CAATGGATTGATGTTTGCGTGA

Download CDS Sequence

Protein sequence (LotjaGi5g1v0285600.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSPSLSRLPVLPDELIYEILVKLPVKSLLQFRCVCKLWKTLISHTQFVNDHLHASNTIMNHKRLVLVYDYSTKATTYSMN SFFQNPPTLTEKLTFKIGGKHIFIGSLNGLMFA

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
Gene3D	G3DSA:1.20.1280.50 View details on G3DSA:1.20.1280.50 Search for proteins/transripts with this domain View external data on G3DSA:1.20.1280.50	3	91	89	1.4E-9	–
PANTHER	PTHR31790 View details on PTHR31790 Search for proteins/transripts with this domain View external data on PTHR31790	4	111	108	7.7E-20	–
PANTHER	PTHR31790:SF258 View details on PTHR31790:SF258 Search for proteins/transripts with this domain View external data on PTHR31790:SF258	4	111	108	7.7E-20	–
ProSiteProfiles	PS50181 View details on PS50181 Search for proteins/transripts with this domain View external data on PS50181	5	51	47	11.352	IPR001810 Show description in modal box View details on IPR001810 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF81383 View details on SSF81383 Search for proteins/transripts with this domain View external data on SSF81383	6	57	52	1.57E-14	IPR036047 Show description in modal box View details on IPR036047 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF00646 View details on PF00646 Search for proteins/transripts with this domain View external data on PF00646	9	44	36	7.2E-9	IPR001810 Show description in modal box View details on IPR001810 Search for proteins/transripts with this domain View on EBI InterPro Service
SMART	SM00256 View details on SM00256 Search for proteins/transripts with this domain View external data on SM00256	11	51	41	6.7E-10	IPR001810 Show description in modal box View details on IPR001810 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0005515 View details of GO:0005515 AmiGO InterPro QuickGO	Molecular function	Protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).	Subterm of View details of GO:0005488

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi5g1v0285600.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…