Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi1g1v0046600 |
Transcript ID | LotjaGi1g1v0046600.2 |
Related isoforms 1 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Oxygen-evolving enhancer protein 2-1, chloroplastic; TAIR: AT1G06680.1 photosystem II subunit P-1; Swiss-Prot: sp|P16059|PSBP_PEA Oxygen-evolving enhancer protein 2, chloroplastic; TrEMBL-Plants: tr|A0A0L9UVJ1|A0A0L9UVJ1_PHAAN Uncharacterized protein; Found in the gene: LotjaGi1g1v0046600 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr1:6357798..6358951) extracted from Lotus japonicus Gifu genome v1.2.
ATGACTTGAGCATTTAGATATTGGTGTTCTGCAAATTTTTAGAAAATGTTGAGCAATATTGATTGTTTTGCTTGCAGCCA ATGTGTTTGGAAAACCAAAGACCAACACAGACTTCCTCCCATACAATGGAGATGGATTCAAACTTTCTGTTCCCTCGAAG TGGAACCCAAGCAAAGAGGTTGAGTACACAGGTCAGGTTCTTAGATATGAGGACAACTTTGATTCAACCAGCAATGTCGT TGTCACAGTGACTCCAACTGATAAGAAGTCCATCACTGACTATGGTTCACCTGAGGAGTTCCTCTCTAAGGTATAGACTA TAGTACTTGTTTTGAACTAGTACTTATGCTGGTTTTCTAACCAATAAGAAACAAAAGTTATAGCTTGAATGATTATCATT GAAAAAGTACAATGTCTATAAACTTTTGAAGACAATGAGAACAGTTGCTACTTGCTGGTTGAAATTCAAGATTTGATGTT TCATCTTTGCAGGTGGATTATTTACTAGGAAAACAGGCCTTCTTCGGCGAAACTCAAGCTGAGGTAATGTGACTGAGAAT TAAACACAAAAAATGAGTAAACCATCATTTTGCTACCTGAAAGGTATTGAGATGGTCACTATAGTCCTTGAAATATAGAA ATCACATTTTTCCTCCCCACAAAGATGAAAAAGGCAATCAATTTAGTGATTTTCAGGGACTTAATTGATGTTTCAAAAGG ACTATATTGATTGCATTTTTCATCTTTGATGGATGAAAAAGATAATTACCATCTTTCAGGGATTAAAGTAACTGTCTTGA TATCTTTTTAGGACTGAAATGATGGCTTACTCAACAAATAATGCACCAAATATTATTGCATATACTAACTTAGTATGCAC TATAATTTTTCAGGGTGGTTTTGATCCAAATGCTGTTGCCACCGCAAACATCTTAGAGAGTTCAACACCTGTTGTTGACG GGAAACAGTACTATGTTTTGACTGTGTTGACAAGGACTGCTGATGGAGATGAAGGTGGTAAGCACCAACTGATTAGAGCA GCTGTGAAAGATGGAAAGCTATACATTTGCAAGGCTCAAGCCGGAGACAAGAGGTGGTTCAAAGGAGCAAGAAGATATGT GGAGAGCACAGCAAGTTCTTTCAGTGTTGCTTAA
CDS sequence (LotjaGi1g1v0046600.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGTTCACCTGAGGAGTTCCTCTCTAAGGTATAGACTATATTCATCTTTGCAGGTGGATTATTTACTAGGAAAACAGGC CTTCTTCGGCGAAACTCAAGCTGAGGGTGGTTTTGATCCAAATGCTGTTGCCACCGCAAACATCTTAGAGAGTTCAACAC CTGTTGTTGACGGGAAACAGTACTATGTTTTGACTGTGTTGACAAGGACTGCTGATGGAGATGAAGGTGGTAAGCACCAA CTGATTAGAGCAGCTGTGAAAGATGGAAAGCTATACATTTGCAAGGCTCAAGCCGGAGACAAGAGGTGGTTCAAAGGAGC AAGAAGATATGTGGAGAGCACAGCAAGTTCTTTCAGTGTTGCTTAA
Protein sequence (LotjaGi1g1v0046600.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MVHLRSSSLRYRLYSSLQVDYLLGKQAFFGETQAEGGFDPNAVATANILESSTPVVDGKQYYVLTVLTRTADGDEGGKHQ LIRAAVKDGKLYICKAQAGDKRWFKGARRYVESTASSFSVA
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
Gene3D | 14 | 121 | 108 | 3.4E-42 | ||
PANTHER | 18 | 119 | 102 | 5.4E-64 | – | |
PANTHER | 18 | 119 | 102 | 5.4E-64 | – | |
Pfam | 18 | 120 | 103 | 1.6E-17 | ||
SUPERFAMILY | 19 | 120 | 102 | 1.36E-30 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | Calcium ion binding | Interacting selectively and non-covalently with calcium ions (Ca2+). | ||
Cellular component | Photosystem II | A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center. | ||
Cellular component | Photosystem II oxygen evolving complex | A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ). | ||
Biological process | Photosynthesis | The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds. | ||
Cellular component | Extrinsic component of membrane | The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region. |
Expression pattern of LotjaGi1g1v0046600.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…