Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi1g1v0445900.5

Overview

Field Value
Gene ID LotjaGi1g1v0445900
Transcript ID LotjaGi1g1v0445900.5
Related isoforms 6
Lotus japonicus genome version Gifu v1.2
Description Proteasome subunit alpha type; TAIR: AT3G22110.1 20S proteasome alpha subunit C1; Swiss-Prot: sp|O81148|PSA4A_ARATH Proteasome subunit alpha type-4-A; TrEMBL-Plants: tr|I3S0L1|I3S0L1_MEDTR Proteasome subunit alpha type; Found in the gene: LotjaGi1g1v0445900
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr1:94483053..94483805) extracted from Lotus japonicus Gifu genome v1.2.

ATGTCTAGAAGATATGATAGCCGCACAACAATCTTCTCTCCTGAAGGACGTCTTTACCAAGTGGAGTATGCAATGGAGGC CATCGGAAACGCTGGTACTGCAATCGGGATCTTGTCAAAAGATGGGGTTGTTCTGGTTGGTGAGAAGAAAGTGACATCCA AGCTGCTGCAAACCTCAACTTCCACTGAGAAAATGTACAAGATTGATGATCATGTTGCGTGCGCAGTGGCTGGGATCATG TCTGATGCCAACATCCTCATCAACACTGCTAGGATCCAAGCTCAACGTTACACTTTCGCGTACCAAGAGCCAATGCCTGT TGAGCAGTTGGTTCAATCTCTTTGTGATACCAAGCAAGGTTACACACAATTCGGTGGTCTTCGGCCATTTGGAGTCTCAT TCCTGTTCGCAGGGTGGGACAAAAATTTCGGCTTTCAACTTTACATGAGTGACCCTAGTGGAAATTATGGCGGATGGAAA GCTTCAGCTATTGGTGCCAACAACCAGGCAGCACAGTCAATTCTGAAACAGGACTACAAGGATGATATCACAAGGGAGGA AGCAGTTCAACTTGCACTGAAGGTACTGAGTAAAACTATGGACAGCACAAGTCTCACCTCGGAAAAGCTTGAACTTGCAG AGGTATTCCTCTCACCCAATGGAGAAGTCAAGTATCAAGTTTGCTCCCCAGAAGCCTTGACGAAGCTGTTGGTCAAGTCT GGCGTGACCCAACCAGCAACAGACACTGCTTAG 

CDS sequence (LotjaGi1g1v0445900.5) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGTCTAGAAGATATGATAGCCGCACAACAATCTTCTCTCCTGAAGGACGTCTTTACCAAGTGGAGTATGCAATGGAGGC CATCGGAAACGCTGGTACTGCAATCGGGATCTTGTCAAAAGATGGGGTTGTTCTGGTTGGTGAGAAGAAAGTGACATCCA AGCTGCTGCAAACCTCAACTTCCACTGAGAAAATGTACAAGATTGATGATCATGTTGCGTGCGCAGTGGCTGGGATCATG TCTGATGCCAACATCCTCATCAACACTGCTAGGATCCAAGCTCAACGTTACACTTTCGCGTACCAAGAGCCAATGCCTGT TGAGCAGTTGGTTCAATCTCTTTGTGATACCAAGCAAGGTTACACACAATTCGGTGGTCTTCGGCCATTTGGAGTCTCAT TCCTGTTCGCAGGGTGGGACAAAAATTTCGGCTTTCAACTTTACATGAGTGACCCTAGTGGAAATTATGGCGGATGGAAA GCTTCAGCTATTGGTGCCAACAACCAGGCAGCACAGTCAATTCTGAAACAGGACTACAAGGATGATATCACAAGGGAGGA AGCAGTTCAACTTGCACTGAAGGTATTCCTCTCACCCAATGGAGAAGTCAAGTATCAAGTTTGCTCCCCAGAAGCCTTGA CGAAGCTGTTGGTCAAGTCTGGCGTGACCCAACCAGCAACAGACACTGCTTAG 

Protein sequence (LotjaGi1g1v0445900.5) extracted from Lotus japonicus Gifu v1.2 Proteins.

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGTAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIM SDANILINTARIQAQRYTFAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNFGFQLYMSDPSGNYGGWK ASAIGANNQAAQSILKQDYKDDITREEAVQLALKVFLSPNGEVKYQVCSPEALTKLLVKSGVTQPATDTA 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
Gene3D 1 220 220 5.0E-89
PANTHER 2 196 195 1.2E-120
PANTHER 2 196 195 1.2E-120
CDD 3 196 194 3.42999E-150
SUPERFAMILY 4 199 196 1.49E-76
Pfam 5 27 23 1.1E-13
ProSitePatterns 5 27 23 -
SMART 5 27 23 3.4E-11
ProSiteProfiles 20 230 211 81.394
Pfam 30 196 167 1.1E-57

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Molecular function Endopeptidase activity Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
Molecular function Threonine-type endopeptidase activity Catalysis of the hydrolysis of internal peptide bonds in a polypeptide chain by a mechanism in which the hydroxyl group of a threonine residue at the active center acts as a nucleophile.
Cellular component Proteasome core complex A multisubunit barrel shaped endoprotease complex, which is the core of the proteasome complex.
Biological process Ubiquitin-dependent protein catabolic process The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
Cellular component Proteasome core complex, alpha-subunit complex The proteasome core subcomplex that constitutes the two outer rings of the proteasome core complex. An example of this component is found in Mus musculus.
Biological process Proteolysis involved in cellular protein catabolic process The hydrolysis of a peptide bond or bonds within a protein as part of the chemical reactions and pathways resulting in the breakdown of a protein by individual cells.

Expression data

Expression pattern

Expression pattern of LotjaGi1g1v0445900.5, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…