Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi3g1v0111900 |
Transcript ID | LotjaGi3g1v0111900.4 |
Related isoforms 3 | |
Lotus japonicus genome version | Gifu v1.2 |
Description | Orotidine 5'-phosphate decarboxylase; TAIR: AT3G54470.1 uridine 5'-monophosphate synthase / UMP synthase (PYRE-F) (UMPS); Swiss-Prot: sp|Q42942|UMPS_TOBAC Uridine 5'-monophosphate synthase; TrEMBL-Plants: tr|G7IYW1|G7IYW1_MEDTR Uridine 5-monophosphate synthase-like protein; Found in the gene: LotjaGi3g1v0111900 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr3:13806878..13807658) extracted from Lotus japonicus Gifu genome v1.2.
ACAGGAAAGAGGTTGTTTGAGATAATGGCTGAGAAGGAGAGTAATCTGTGTTTGGCTGCAGATGTTGGAACTGCCGCTGA ATTGCTTGAAATCGCTGAGAAGGTGAGAACTTGGTAATTTTCTTGGTAAAATAAAATCTCCCATAGCAATGAGGAAATCA TTTTTAGGGACAAATACTATTCTTTTCACATGGACTCAGCTAGCGAAGTATTCTTTTCATTTATTTTTTTAATTAGTCCA TGGCATGTTGTGTTCTCTCTTGTATACTTGAAAAGTCCTGTGTTCTCTGGCTTATTGTCACCAACTGGATTGTAATTAGA AGTTTGGCCATAACAATTAATTTTCTGTTAACTAATTTTGCTGGTTTTCTGTCAGGTTGGACCTGAGATATGTTTGCTGA AGACTCATGTGGATATTTTGCCAGATTTCACTCCTGATTTTGGCTCCAAGCTTCTTTCGGTATAGTTCTACAAGAACCCC TGTTGTGTTCACATGTCTCTTTTTCTTTTGAGATATCAGAAGAAACTTTTCATTCCTGATAATACTAACACTAAAAGATT TCTAGCATTTATCAAAATGGAATGGTGATTTATATATGACTATGTATGCTTTATCCTATTGAAGATTGCAGAAAAGCATA ACTTCTTAATCTTTGAGGATCGTAAATTTGCTGACATTGGTAACACAGTGACCATGCAATATGAAGGGTGAGACTTCGAT CAACTATCTTGGATTCCTTTTCTAGTTGGATTCTTCTCATATGTTTCTGAATTCAATATGA
CDS sequence (LotjaGi3g1v0111900.4) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGCTGAGAAGGAGAGTAATCTGTGTTTGGCTGCAGATGTTGGAACTGCCGCTGAATTGCTTGAAATCGCTGAGAAGGT TGGACCTGAGATATGTTTGCTGAAGACTCATGTGGATATTTTGCCAGATTTCACTCCTGATTTTGGCTCCAAGCTTCTTT CGATTGCAGAAAAGCATAACTTCTTAATCTTTGAGGATCGTAAATTTGCTGACATTGGTAACACAGTGACCATGCAATAT GAAGGGTTTCTGAATTCAATATGA
Protein sequence (LotjaGi3g1v0111900.4) extracted from Lotus japonicus Gifu v1.2 Proteins.
MAEKESNLCLAADVGTAAELLEIAEKVGPEICLLKTHVDILPDFTPDFGSKLLSIAEKHNFLIFEDRKFADIGNTVTMQY EGFLNSI
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
PANTHER | 1 | 84 | 84 | 1.0E-48 | – | |
PANTHER | 1 | 84 | 84 | 1.0E-48 | – | |
Gene3D | 1 | 87 | 87 | 1.8E-32 | ||
SUPERFAMILY | 2 | 84 | 83 | 6.28E-22 | ||
Pfam | 6 | 82 | 77 | 1.2E-29 | ||
ProSitePatterns | 63 | 76 | 14 | - |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | Catalytic activity | Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic. | ||
Molecular function | Orotidine-5'-phosphate decarboxylase activity | Catalysis of the reaction: H(+) + orotidine 5'-phosphate = CO(2) + UMP. | ||
Biological process | 'de novo' pyrimidine nucleobase biosynthetic process | The chemical reactions and pathways resulting in the formation of pyrimidine nucleobases, 1,3-diazine, organic nitrogenous bases, beginning with the synthesis of a pyrimidine ring from simpler precursors. |
Expression pattern of LotjaGi3g1v0111900.4, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…