Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi1g1v0054200.4

Overview

Field	Value
Gene ID	LotjaGi1g1v0054200
Transcript ID	LotjaGi1g1v0054200.4
Related isoforms 3	LotjaGi1g1v0054200.1 LotjaGi1g1v0054200.2 LotjaGi1g1v0054200.3
Lotus japonicus genome version	Gifu v1.2
Description	Chaperone protein dnaJ-like; TAIR: AT3G17668.1 DnaJ/Hsp40 cysteine-rich domain superfamily protein; Swiss-Prot: sp\|Q8GSJ6\|LQY1_ARATH Protein disulfide-isomerase LQY1, chloroplastic; TrEMBL-Plants: tr\|K7KB52\|K7KB52_SOYBN Uncharacterized protein; Found in the gene: LotjaGi1g1v0054200
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr1:7649048..7649467) extracted from Lotus japonicus Gifu genome v1.2.

ATGGGTTTCGGGACGCTGAGTTTATCAAGAACAGTTCGATTTGAGGCGACAAGTTTCAATGGTTTGCCCCCGCCTCGGCC CCCTAAGTCGTTGCCTCATTTGTCACTCACAAAGCCATCCTGGGTCGTGAGGACGGAGTCTAATGTTCGGAAGAAGAGAA GAAAGACGCCGGATCCCCCGTGTGTGGTGTGTGAGGGGAGTGGACGAGTTGATTGTCACGAATGTTGTGGAAGAGGAAGG ACAAACCTGGTTCATTTGGAAATGCTCCCAAATGGTGAATGGCCAAAATGGTGTAGGACTTGTGGTGGAAGTGGTCTTAG TTACTGCTCTCGTTGCCTTGGTACTGGAGAATATAGGTATATTATGGGCTTCCATTTCATGAAAAGGGAAAACAATGAAT CCCAGGAAAACAAGTCTTAG

Download Genomic Sequence

CDS sequence (LotjaGi1g1v0054200.4) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGGTTTCGGGACGCTGAGTTTATCAAGAACAGTTCGATTTGAGGCGACAAGTTTCAATGGTTTGCCCCCGCCTCGGCC CCCTAAGTCGTTGCCTCATTTGTCACTCACAAAGCCATCCTGGGTCGTGAGGACGGAGTCTAATGTTCGGAAGAAGAGAA GAAAGACGCCGGATCCCCCGTGTGTGGTGTGTGAGGGGAGTGGACGAGTTGATTGTCACGAATGTTGTGGAAGAGGAAGG ACAAACCTGGTTCATTTGGAAATGCTCCCAAATGGTGAATGGCCAAAATGGTGTAGGACTTGTGGTGGAAGTGGTCTTAG TTACTGCTCTCGTTGCCTTGGTACTGGAGAATATAGGTATATTATGGGCTTCCATTTCATGAAAAGGGAAAACAATGAAT CCCAGGAAAACAAGTCTTAG

Download CDS Sequence

Protein sequence (LotjaGi1g1v0054200.4) extracted from Lotus japonicus Gifu v1.2 Proteins.

MGFGTLSLSRTVRFEATSFNGLPPPRPPKSLPHLSLTKPSWVVRTESNVRKKRRKTPDPPCVVCEGSGRVDCHECCGRGR TNLVHLEMLPNGEWPKWCRTCGGSGLSYCSRCLGTGEYRYIMGFHFMKRENNESQENKS

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR15852 View details on PTHR15852 Search for proteins/transripts with this domain View external data on PTHR15852	10	138	129	2.6E-64	–
PANTHER	PTHR15852:SF54 View details on PTHR15852:SF54 Search for proteins/transripts with this domain View external data on PTHR15852:SF54	10	138	129	2.6E-64	–
SUPERFAMILY	SSF57938 View details on SSF57938 Search for proteins/transripts with this domain View external data on SSF57938	60	118	59	1.22E-7	IPR036410 Show description in modal box View details on IPR036410 Search for proteins/transripts with this domain View on EBI InterPro Service

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

Unable to find any GO terms for the transcript with the identifier.

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi1g1v0054200.4, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…