Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi1g1v0149100 |
| Transcript ID | LotjaGi1g1v0149100.4 |
| Related isoforms 4 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Sulfate transporter; TAIR: AT1G78000.7 sulfate transporter 1;2; Swiss-Prot: sp|P53391|SUT1_STYHA High affinity sulfate transporter 1; TrEMBL-Plants: tr|A0A0K1U4B3|A0A0K1U4B3_PEA Sulfate transporter 1.3-like protein; Found in the gene: LotjaGi1g1v0149100 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr1:25549294..25549980) extracted from Lotus japonicus Gifu genome v1.2.
ACTAATATTTTACAGCCTCTGATCTTCCTTTTGCTATACTCAGGTTCTTTCTCTCGATCAGCTGTGAATTACATGTCCGG CTGCCAAACTGCAGTGTCTAATATTGTCATGTCCTTTGTTGTGTTCTTAACCCTGCTATTCATCACACCTCTTTTCAAAT ACACTCCAAATGCCATTCTTGCTTCAATTATCATTTCTGCTGTCATAAACCTTGTGGACTACAAGGCAGCAATTTTGATA TGGAAGGTCGATAAATTTGACTTCGTCGCTTGCGTGGGAGCATTTTTCGGGGTTGTTTTCGCCTCGGTTGAGATAGGGCT TCTGATTGCTGTAAGTATTAAAAGTTTAAAACTAGTTATCTTTATATAATTGGTGGTTTTTAGGTTTTTTTTTTCGGAAA TTTGTGTTTTGAGTTATGAAGTCTCACATTGGTTAGAAGTGGGTTAAGCGAGGACAACTTAACTAACAAGTTATTGTTAC ACTTTGTGGTAGGTCTCTATATCCTTCGCAAAGATCCTATTACAGGTAACAAGGCCGCGAACTGCTATTCTGGGGAAGAT TCCTAGGACAACTGTATATAGAAACATCCAACAATACCCAGAGGCCACGAGCGTTCCTGGTGTACTAATTATAAGGGTTG ATTCTGCAATATATTTTTCCAACTCAAATTATGTTAGAGAAAGGTAA
CDS sequence (LotjaGi1g1v0149100.4) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGTCCGGCTGCCAAACTGCAGTGTCTAATATTGTCATGTCCTTTGTTGTGTTCTTAACCCTGCTATTCATCACACCTCT TTTCAAATACACTCCAAATGCCATTCTTGCTTCAATTATCATTTCTGCTGTCATAAACCTTGTGGACTACAAGGCAGCAA TTTTGATATGGAAGGTCGATAAATTTGACTTCGTCGCTTGCGTGGGAGCATTTTTCGGGGTTGTTTTCGCCTCGGTTGAG ATAGGGCTTCTGATTGCTGTCTCTATATCCTTCGCAAAGATCCTATTACAGGTAACAAGGCCGCGAACTGCTATTCTGGG GAAGATTCCTAGGACAACTGTATATAGAAACATCCAACAATACCCAGAGGCCACGAGCGTTCCTGGTGTACTAATTATAA GGGTTGATTCTGCAATATATTTTTCCAACTCAAATTATGTTAGAGAAAGGTAA
Protein sequence (LotjaGi1g1v0149100.4) extracted from Lotus japonicus Gifu v1.2 Proteins.
MSGCQTAVSNIVMSFVVFLTLLFITPLFKYTPNAILASIIISAVINLVDYKAAILIWKVDKFDFVACVGAFFGVVFASVE IGLLIAVSISFAKILLQVTRPRTAILGKIPRTTVYRNIQQYPEATSVPGVLIIRVDSAIYFSNSNYVRER
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| Phobius | 1 | 6 | 6 | - | – | |
| PANTHER | 1 | 150 | 150 | 1.2E-92 | ||
| PANTHER | 1 | 150 | 150 | 1.2E-92 | – | |
| Pfam | 2 | 68 | 67 | 1.3E-19 | ||
| TMHMM | 7 | 25 | 19 | - | – | |
| Phobius | 7 | 28 | 22 | - | – | |
| Phobius | 29 | 33 | 5 | - | – | |
| Phobius | 34 | 57 | 24 | - | – | |
| TMHMM | 35 | 57 | 23 | - | – | |
| Phobius | 58 | 63 | 6 | - | – | |
| Phobius | 64 | 92 | 29 | - | – | |
| TMHMM | 64 | 86 | 23 | - | – | |
| Phobius | 93 | 150 | 58 | - | – | |
| Gene3D | 100 | 150 | 51 | 2.1E-15 | ||
| ProSiteProfiles | 120 | 150 | 31 | 10.544 | ||
| Pfam | 121 | 150 | 30 | 8.2E-5 |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | Secondary active sulfate transmembrane transporter activity | Enables the secondary active transfer of sulfate from one side of a membrane to the other. Secondary active transport is the transfer of a solute across a membrane, up its concentration gradient. The transporter binds the solute and undergoes a series of conformational changes. Transport works equally well in either direction and is driven by a chemiosmotic source of energy. Secondary active transporters include symporters and antiporters. | ||
| Biological process | Sulfate transport | The directed movement of sulfate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. | ||
| Molecular function | Sulfate transmembrane transporter activity | Enables the transfer of sulfate ions, SO4(2-), from one side of a membrane to the other. | ||
| Cellular component | Membrane | A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it. | ||
| Cellular component | Integral component of membrane | The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane. | ||
| Biological process | Transmembrane transport | The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other. |
Expression pattern of LotjaGi1g1v0149100.4, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…