Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi1g1v0369300.1

Overview

Field	Value
Gene ID	LotjaGi1g1v0369300
Transcript ID	LotjaGi1g1v0369300.1
Lotus japonicus genome version	Gifu v1.2
Description	Heat shock protein; TAIR: AT5G12020.1 17.6 kDa class II heat shock protein; Swiss-Prot: sp\|Q01545\|HSP22_IPONI 18.8 kDa class II heat shock protein; TrEMBL-Plants: tr\|A0A1J7H3V3\|A0A1J7H3V3_LUPAN Uncharacterized protein; Found in the gene: LotjaGi1g1v0369300
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr1:84767060..84768138) extracted from Lotus japonicus Gifu genome v1.2.

GTAATCACTAGTTCATTACCTCCTCCTTCAGAACTTCACCTCTATTATATATATAACATGCATTGCTTAATACATACATG AAGACACAATTACACACACATAATGGATTATATGAGGCAATTTGGGTTCGATCCTCATCTGGTGGATTTCCTGGTGGACC ACCTAGATTTCACCGATGAAACAGACACCAAGTCCTCCCACTACACGCCGTCTCGAGCCTACGTGCGAGACTCCAAGGCG ATGGCGAACACGCACGCCGACATCATTGATTCTCCAGAGGCGTACAAGTTCGTGGTGGACATGCCGGGGCTGAAGTTAGA GCAGATAAAAGTGAGCATGGAGGAAAACACGCTGGTGGTGAGTGGAGAGAGGAGGCAGAGGGACAAGGATAAGGATCACA AAGAAGGGGTGAAGTACATTCGCATGGAGAGGAGGCAAGGCAAGTTTCTTAAGAAGTTTCAGCTTCCTGAGAATGCTGAT TGTGATGGAGTGTGTGCTAGTTATCAGGATGGGGTTTTGACTGTCACTGTGCGGAAGAAGCCGCCGCCGGAGCCCAAGAA GCCCAAGACCATTCAGGTCCAAGTTAGCTCTCATGAACCTCAGGCCCAACATCAAGGCCAGCCCCAAGCCCAAGAAGATA ATGGCCAGCAGGGATGATATGAATGTGCTTGCCACTGTGGTTTATCGTTTATAGATGTGCATATGTATAAAATGGTTCTG TGGATGTGTTTTATTTTCTGTTTGTGTGTGCTTGCACTTACATATATACATACTCTTATGTTTTTTTGTGAGGTCGATGT AACTGTTTCTCCAGCTTGGTTTGTATAATATACAAAAAGAAAAAATGATACTATAATCCTATATACCTTTGCTAGTGTAT AAGTGATTATTTGTCTATGCTTTAAAGTTCTATCACTATCTCAACAGAACTATTATCACATAACACATCTATTTATTTAG GCTAGGTTGTTTCGAAAAATTTTAAAATTAGAACTATCAAAAGTTGTTGTTTTGCTAATTATATTCACAATAATCAACCA CTGTGGCAAGACGTCTTTTCATCAACATTTACTTCTTGG

Download Genomic Sequence

CDS sequence (LotjaGi1g1v0369300.1) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGATTATATGAGGCAATTTGGGTTCGATCCTCATCTGGTGGATTTCCTGGTGGACCACCTAGATTTCACCGATGAAAC AGACACCAAGTCCTCCCACTACACGCCGTCTCGAGCCTACGTGCGAGACTCCAAGGCGATGGCGAACACGCACGCCGACA TCATTGATTCTCCAGAGGCGTACAAGTTCGTGGTGGACATGCCGGGGCTGAAGTTAGAGCAGATAAAAGTGAGCATGGAG GAAAACACGCTGGTGGTGAGTGGAGAGAGGAGGCAGAGGGACAAGGATAAGGATCACAAAGAAGGGGTGAAGTACATTCG CATGGAGAGGAGGCAAGGCAAGTTTCTTAAGAAGTTTCAGCTTCCTGAGAATGCTGATTGTGATGGAGTGTGTGCTAGTT ATCAGGATGGGGTTTTGACTGTCACTGTGCGGAAGAAGCCGCCGCCGGAGCCCAAGAAGCCCAAGACCATTCAGGTCCAA GTTAGCTCTCATGAACCTCAGGCCCAACATCAAGGCCAGCCCCAAGCCCAAGAAGATAATGGCCAGCAGGGATGA

Download CDS Sequence

Protein sequence (LotjaGi1g1v0369300.1) extracted from Lotus japonicus Gifu v1.2 Proteins.

MDYMRQFGFDPHLVDFLVDHLDFTDETDTKSSHYTPSRAYVRDSKAMANTHADIIDSPEAYKFVVDMPGLKLEQIKVSME ENTLVVSGERRQRDKDKDHKEGVKYIRMERRQGKFLKKFQLPENADCDGVCASYQDGVLTVTVRKKPPPEPKKPKTIQVQ VSSHEPQAQHQGQPQAQEDNGQQG

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR11527:SF273 View details on PTHR11527:SF273 Search for proteins/transripts with this domain View external data on PTHR11527:SF273	8	162	155	2.5E-65	–
PANTHER	PTHR11527 View details on PTHR11527 Search for proteins/transripts with this domain View external data on PTHR11527	8	162	155	2.5E-65	IPR031107 Show description in modal box View details on IPR031107 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:2.60.40.790 View details on G3DSA:2.60.40.790 Search for proteins/transripts with this domain View external data on G3DSA:2.60.40.790	16	161	146	9.5E-33	IPR008978 Show description in modal box View details on IPR008978 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF49764 View details on SSF49764 Search for proteins/transripts with this domain View external data on SSF49764	30	154	125	4.19E-35	IPR008978 Show description in modal box View details on IPR008978 Search for proteins/transripts with this domain View on EBI InterPro Service
ProSiteProfiles	PS01031 View details on PS01031 Search for proteins/transripts with this domain View external data on PS01031	43	162	120	27.696	IPR002068 Show description in modal box View details on IPR002068 Search for proteins/transripts with this domain View on EBI InterPro Service
CDD	cd06464 View details on cd06464 Search for proteins/transripts with this domain View external data on cd06464	53	143	91	6.92828E-30	–
Pfam	PF00011 View details on PF00011 Search for proteins/transripts with this domain View external data on PF00011	53	160	108	1.6E-29	IPR002068 Show description in modal box View details on IPR002068 Search for proteins/transripts with this domain View on EBI InterPro Service
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	142	184	43	-	–
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	156	184	29	-	–

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

Unable to find any GO terms for the transcript with the identifier.

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi1g1v0369300.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…