Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
Field | Value |
---|---|
Gene ID | LotjaGi1g1v0386900 |
Transcript ID | LotjaGi1g1v0386900.1 |
Lotus japonicus genome version | Gifu v1.2 |
Description | AGAMOUS-like MADS-box protein; TAIR: AT1G31640.1 AGAMOUS-like 92; Swiss-Prot: sp|Q9C6V4|AGL92_ARATH Agamous-like MADS-box protein AGL92; TrEMBL-Plants: tr|A0A072UXE2|A0A072UXE2_MEDTR MADS-box transcription factor family protein; Found in the gene: LotjaGi1g1v0386900 |
Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr1:87026589..87027465) extracted from Lotus japonicus Gifu genome v1.2.
CCCGTACCATATTTTTTGCTCAATACTATCATCATCATGGTTAGCGCTAGAGGCAAAGTGAAGCTCACGCGCATACTTGA GCGGAGCAAGAGGAAGTCATCATGGAAAAAGAGGGTAGCAGGCGCAAAGAAGAAGCTGAGTGAGGTTACCACCCTTTGTG ATGTCAAAGCATGTCTTATAATGTACCCTCTTGATGACCCTCTTGATCATAAACCTCTTGAGACAGTTGTTTGGCCATCC CATGAGGGCGCCCGAGAAGTGATAGCTAAGTACATGAGCGAGAATGAGCTCGTACGCGGCAAAAGGATGGCCAACCCAGA GAGCCACATGCAAGAAATGGTCGTGAAGGCCACGGCGAAATTGGACAAGCAAATGTATGAAATCAAAATTAAACAGATGA AACTTTGCATGATGAAGTGTTTTGAGATCGGTAGGGTTCCACCTAATTTGAGCCTGGATGATACCAATCTTATGGGCAAC CTGATTGACCGTTATCTGATGGACATTGATTTAAGGCTGAAGAAACTTGAGATGGAAGAAGAGGAGGCTCATCAGAACCA AGCTGCCACAACTGTTGCTGGTGCATCTAGGAACAAAGGAAAGGAACCTATGAACTATGATGCATCTAGGAACAAAGGAA AGGAACCTATGAACTATGATGCATCTAGGAACAAAGGAAAGGAACCTATGAACTATGACTAGGGTTTCTTGAAAAATCCA AAGCGTTTCTCGGCCAATCACTCCATTCCTTTAAAATTTCAGTTCTTGTTGATTTTGATGTCATGTTTGTTTTTGTTTTT TTGTCCCCAATAATGTATGGTGATCTCTATTGTTCACCTTGGTATTTCCTAGTTTCAATAATAAAGTGATTGGTTTT
CDS sequence (LotjaGi1g1v0386900.1) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGTTAGCGCTAGAGGCAAAGTGAAGCTCACGCGCATACTTGAGCGGAGCAAGAGGAAGTCATCATGGAAAAAGAGGGT AGCAGGCGCAAAGAAGAAGCTGAGTGAGGTTACCACCCTTTGTGATGTCAAAGCATGTCTTATAATGTACCCTCTTGATG ACCCTCTTGATCATAAACCTCTTGAGACAGTTGTTTGGCCATCCCATGAGGGCGCCCGAGAAGTGATAGCTAAGTACATG AGCGAGAATGAGCTCGTACGCGGCAAAAGGATGGCCAACCCAGAGAGCCACATGCAAGAAATGGTCGTGAAGGCCACGGC GAAATTGGACAAGCAAATGTATGAAATCAAAATTAAACAGATGAAACTTTGCATGATGAAGTGTTTTGAGATCGGTAGGG TTCCACCTAATTTGAGCCTGGATGATACCAATCTTATGGGCAACCTGATTGACCGTTATCTGATGGACATTGATTTAAGG CTGAAGAAACTTGAGATGGAAGAAGAGGAGGCTCATCAGAACCAAGCTGCCACAACTGTTGCTGGTGCATCTAGGAACAA AGGAAAGGAACCTATGAACTATGATGCATCTAGGAACAAAGGAAAGGAACCTATGAACTATGATGCATCTAGGAACAAAG GAAAGGAACCTATGAACTATGACTAG
Protein sequence (LotjaGi1g1v0386900.1) extracted from Lotus japonicus Gifu v1.2 Proteins.
MVSARGKVKLTRILERSKRKSSWKKRVAGAKKKLSEVTTLCDVKACLIMYPLDDPLDHKPLETVVWPSHEGAREVIAKYM SENELVRGKRMANPESHMQEMVVKATAKLDKQMYEIKIKQMKLCMMKCFEIGRVPPNLSLDDTNLMGNLIDRYLMDIDLR LKKLEMEEEEAHQNQAATTVAGASRNKGKEPMNYDASRNKGKEPMNYDASRNKGKEPMNYD
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
---|---|---|---|---|---|---|
SMART | 3 | 62 | 60 | 2.0E-4 | ||
ProSiteProfiles | 3 | 50 | 48 | 13.75 | ||
CDD | 4 | 93 | 90 | 3.37638E-16 | ||
SUPERFAMILY | 5 | 100 | 96 | 4.97E-14 | ||
PRINTS | 5 | 25 | 21 | 1.5E-5 | ||
PANTHER | 6 | 163 | 158 | 1.1E-24 | – | |
PANTHER | 6 | 163 | 158 | 1.1E-24 | – | |
Pfam | 12 | 50 | 39 | 3.2E-8 | ||
Gene3D | 15 | 107 | 93 | 3.6E-5 | ||
PRINTS | 25 | 40 | 16 | 1.5E-5 | ||
PRINTS | 40 | 61 | 22 | 1.5E-5 | ||
Coils | 154 | 174 | 21 | - | – | |
MobiDBLite | 170 | 221 | 52 | - | – | |
MobiDBLite | 191 | 210 | 20 | - | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
GO term | Namespace | Name | Definition | Relationships |
---|---|---|---|---|
Molecular function | DNA-binding transcription factor activity, RNA polymerase II-specific | A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within the regulatory region of a RNA polymerase II-transcribed gene to modulate transcription. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units. | ||
Molecular function | Proximal promoter sequence-specific DNA binding | Interacting selectively and non-covalently with a specific upstream regulatory DNA sequence (transcription factor recognition sequence or binding site) located in the proximal promoter. The proximal promoter is in cis with and relatively close to the core promoter. | ||
Molecular function | DNA binding | Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). | ||
Biological process | Positive regulation of transcription by RNA polymerase II | Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter. | ||
Molecular function | Protein dimerization activity | The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits. |
Expression pattern of LotjaGi1g1v0386900.1, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…