Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi1g1v0440100 |
| Transcript ID | LotjaGi1g1v0440100.2 |
| Related isoforms 1 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | Mitochondrial inner membrane protease subunit 2; TAIR: AT3G08980.1 Peptidase S24/S26A/S26B/S26C family protein; Swiss-Prot: sp|Q6AZD4|IMP2L_DANRE Mitochondrial inner membrane protease subunit 2; TrEMBL-Plants: tr|I3SVG3|I3SVG3_LOTJA Uncharacterized protein; Found in the gene: LotjaGi1g1v0440100 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr1:93610135..93610456) extracted from Lotus japonicus Gifu genome v1.2.
ATGGGGCCAAGCGGCTTTCTGTGGAATTTTACTAAAAAGTTTGTCACATTTGGGCTCATATCTGTGACTGTGTCCGATCG TTACATGACTGTTGTTCCTGTTCGAGGTGGCTCTATGTCTCCCACATTCAATCCTAAAACTCACTCTTTGATGGGAGGTG TTTCTGGTACTTTTCTTCACAGAGGGGTAAAAAAATGTTTTTAGAATTGCAAATTTTATTGTTTTGACAGTTGTTTGTGC TGCAGATGACTATGTCTTTGTTGAAAAATTTTGCCTTCAGAAGTACAAGTTTTCACATGGTGATGTGGTGGTCTTTCGGT AA
CDS sequence (LotjaGi1g1v0440100.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGGGCCAAGCGGCTTTCTGTGGAATTTTACTAAAAAGTTTGTCACATTTGGGCTCATATCTGTGACTGTGTCCGATCG TTACATGACTGTTGTTCCTGTTCGAGGTGGCTCTATGTCTCCCACATTCAATCCTAAAACTCACTCTTTGATGGGAGGTG TTTCTGATGACTATGTCTTTGTTGAAAAATTTTGCCTTCAGAAGTACAAGTTTTCACATGGTGATGTGGTGGTCTTTCGG TAA
Protein sequence (LotjaGi1g1v0440100.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MGPSGFLWNFTKKFVTFGLISVTVSDRYMTVVPVRGGSMSPTFNPKTHSLMGGVSDDYVFVEKFCLQKYKFSHGDVVVFR
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| SignalP_EUK | 1 | 25 | 25 | - | – | |
| PANTHER | 6 | 80 | 75 | 7.7E-20 | – | |
| PANTHER | 6 | 80 | 75 | 7.7E-20 | ||
| SUPERFAMILY | 30 | 80 | 51 | 3.84E-7 | ||
| CDD | 31 | 80 | 50 | 8.3567E-8 | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Biological process | Signal peptide processing | The proteolytic removal of a signal peptide from a protein during or after transport to a specific location in the cell. | ||
| Biological process | Protein processing involved in protein targeting to mitochondrion | The cleavage of peptide bonds in proteins, usually near the N terminus, contributing to the process of import into the mitochondrion. Several different peptidases mediate cleavage of proteins destined for different mitochondrial compartments. | ||
| Molecular function | Serine-type peptidase activity | Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine). | ||
| Cellular component | Mitochondrial inner membrane peptidase complex | Protease complex of the mitochondrial inner membrane, consisting of at least two subunits, involved in processing of both nuclear- and mitochondrially-encoded proteins targeted to the intermembrane space. |
Expression pattern of LotjaGi1g1v0440100.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…