Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message
| Field | Value |
|---|---|
| Gene ID | LotjaGi1g1v0724100 |
| Transcript ID | LotjaGi1g1v0724100.2 |
| Related isoforms 1 | |
| Lotus japonicus genome version | Gifu v1.2 |
| Description | 30S ribosomal protein S10; TAIR: AT3G45030.1 Ribosomal protein S10p/S20e family protein; Swiss-Prot: sp|P49200|RS201_ARATH 40S ribosomal protein S20-1; TrEMBL-Plants: tr|I3SJC9|I3SJC9_LOTJA Uncharacterized protein; Found in the gene: LotjaGi1g1v0724100 |
| Working Lj name | n.a. |
Genomic sequence (LjG1.1_chr1:129528668..129530130) extracted from Lotus japonicus Gifu genome v1.2.
ATGGCTGCCTTCGCTATGAAGCCTGCAAAACCCGGCTACGAGGAGACCGGGGAGCAAATCCACAAGATCAGGATCACTCT CTCTTCCAAGCATGTCAAGAATCTCGAGAAGGGTATCACTCAATCCATCATAGTTTCCATTTTTTTGCTGTTTGGTTGTG ATTTTCGCTTACCCTTTTGATTGTTTTTGCTGTTTGGTGTTAGTTTGTTCCGACCTGATTCGTGGTGCGAAGGATAAGAG ACTCAGGGTTAAGGGACCAGTTAGGATGCCTACTAAGGTTCTTAACATCACTACCAGGAAGTCCCCTTGTGGAGAAGGTA ATTTAGTTTTGGATTGAAATTCAGTTGTTCTTCATATGATGTGGGTTGCTTAGTTTAAAGATTTGATGTTGATTCAATGA AACTAGTGAAAAGCAAAAATGTGATAATCCGTAGAAATTAACTTGTTTATGGAAAACAAATTTATAATTTTATTGTAATT TTAGTCTTAATTCAATTGAGCTGTGATTCCAATTGTGCTTGAAGGATTGCAAAAAGACTAGTTCTGTCTGTTGTATTTTT GAATTTGTTTTCCTTGTGATTGTGCTTAAGGAGAATTTTGTTGTGTGGTGGAAAATAGTAGTGTTTGTTTTGGCTCCTTG TGTTACAGAGCTGTGAGTTTAGCTATTGGTTTATTCTTAAAGGCTATAACTAGAGGGTGTGCTCTAAGTTTTAGATATTA ACCAATCCTGAAAGTTGTTAGATTTACAAGTTGGTTTGGTTCAATTTTGAAACTTTAATTTGAAGTCAGAGCAAGTTGTC TGATATTTTTTGTACTCATTTTTCTTGAATGGTATCTGGTACTTAAATCAGAATGTTGTTCAACAAATTGTGATGGCTAT TTGCTGTAAATTGACCATCTTATGGATTGTTCTAGTATAAGTTGGAACTGATGCATCGTTTAGTGGTTTCCTAATTGTTA TTTATCTCATGGTTGATTTTCCTCTATGCGTGTGATCTTAGGCCTTATCTTATGTTTTTTGTTATTTTGCAATTTATTTT ATGTATGTGTATGAACTTTCACGTGACCCTGAACATGGGTGACTAATCTTGATAAGTGTCATTCTTCCTGGTCTTAATCC AAAAGTCAAGGAAGTGTAATTTCCTCTGTCACCTGAATTGCATGCTCTTGATCTATCTTTATGAAACTGTTACGCTGTAT TAATATGCCTCATGACCTTACTTTTGAACTATTGTGCTCAGCTTGTATCCTTTTTTGAGTGTTGTGTCTTGTTGAATGAA TGATATTCTGCCTAGTTCATGACACTGCCTCTTGTTTCAGGTACCAACACATGGGATAGGTTTGAACTTCGTGTGCACAA GAGAGTCATTGACCTCTACAGCTCCCCAGACGTGGTCAAGCAGATTACCTCAATCACCATTGAACCTGGTGTTGAGGTTG AGGTTACCATTGCAGATGCTTGA
CDS sequence (LotjaGi1g1v0724100.2) extracted from Lotus japonicus Gifu v1.2 CDS.
ATGGCTGCCTTCGCTATGAAGCCTGCAAAACCCGGCTACGAGGAGACCGGGGAGCAAATCCACAAGATCAGGATCACTCT CTCTTCCAAGCATGTCAAGAATCTCGAGAAGGTTTGTTCCGACCTGATTCGTGGTGCGAAGGATAAGAGACTCAGGGTTA AGGGACCAGTTAGGATGCCTACTAAGGTTCTTAACATCACTACCAGGAAGTCCCCTTGTGGAGAAGACGTGGTCAAGCAG ATTACCTCAATCACCATTGAACCTGGTGTTGAGGTTGAGGTTACCATTGCAGATGCTTGA
Protein sequence (LotjaGi1g1v0724100.2) extracted from Lotus japonicus Gifu v1.2 Proteins.
MAAFAMKPAKPGYEETGEQIHKIRITLSSKHVKNLEKVCSDLIRGAKDKRLRVKGPVRMPTKVLNITTRKSPCGEDVVKQ ITSITIEPGVEVEVTIADA
Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.
| Prediction algorithm | Identifier | Start | End | Length | E-value | InterPro ID |
|---|---|---|---|---|---|---|
| PANTHER | 1 | 76 | 76 | 2.1E-48 | – | |
| PANTHER | 1 | 76 | 76 | 2.1E-48 | ||
| Gene3D | 9 | 74 | 66 | 6.2E-26 | ||
| SUPERFAMILY | 22 | 96 | 75 | 8.89E-18 | ||
| PRINTS | 22 | 35 | 14 | 2.3E-5 | ||
| SMART | 24 | 95 | 72 | 4.7E-13 | ||
| Pfam | 24 | 77 | 54 | 4.7E-14 | ||
| ProSitePatterns | 46 | 61 | 16 | - | ||
| PRINTS | 57 | 72 | 16 | 2.3E-5 | ||
| Gene3D | 75 | 99 | 25 | 2.0E-5 | ||
| PANTHER | 76 | 99 | 24 | 2.1E-48 | ||
| PANTHER | 76 | 99 | 24 | 2.1E-48 | – |
GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .
| GO term | Namespace | Name | Definition | Relationships |
|---|---|---|---|---|
| Molecular function | RNA binding | Interacting selectively and non-covalently with an RNA molecule or a portion thereof. | ||
| Molecular function | Structural constituent of ribosome | The action of a molecule that contributes to the structural integrity of the ribosome. | ||
| Cellular component | Ribosome | An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins. | ||
| Biological process | Translation | The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome. |
Expression pattern of LotjaGi1g1v0724100.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.
Loading expression data from ljgea-geneid. Please wait…