Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi2g1v0116900.3

Overview

Field	Value
Gene ID	LotjaGi2g1v0116900
Transcript ID	LotjaGi2g1v0116900.3
Related isoforms 2	LotjaGi2g1v0116900.1 LotjaGi2g1v0116900.2
Lotus japonicus genome version	Gifu v1.2
Description	ATP-dependent RNA helicase; TAIR: AT4G09730.1 RH39; Swiss-Prot: sp\|Q56X76\|RH39_ARATH DEAD-box ATP-dependent RNA helicase 39; TrEMBL-Plants: tr\|A0A151T4R4\|A0A151T4R4_CAJCA DEAD-box ATP-dependent RNA helicase 39; Found in the gene: LotjaGi2g1v0116900
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr2:43094148..43095167) extracted from Lotus japonicus Gifu genome v1.2.

ATGGTAAGTGGTGGTGGTCGTATTCGGCCTCAGGAGGATTCACTTAATCACCCCATTGATATGGTGGTTGGTACTCCTGG CAGGATTCTTCAACACATTGAGGAGGGAAATATGGTATATGGTGACATCAAATACTTGGTTAGTATCCCAACAATTGACA ATTTTGACTATGCTATAATGAGCTGCAAGCTTCACTTACTGACATTGGTGATTGGTCTTTGTTTTGAAGGTATTGGATGA GGCAGACACAATGTTTGATAAGGGTTTTGGTCCTGATATACGCAAATTTATTGGCCCATTAAAGCATCGTTCTTCAAAGT CTGAGGGGCTAGGTTTTCAGACTGTCTTGGTCACTGCAACCATGACAAATGTACGCTGATTTGCACCATAATATTGTTGG CTACATGCGAAGTAAATATTAATGGTGTAGAAAATAATTCATAGAATGATTATAGTATTATTATAAATTGTTGGTTGTTT GGATTTTGACGTTAACAATTGGATTCTTCTTTCTTCCTGGTTCATATTAAATGTTAAAGACTTTTTCGGGGTATTTGCAG TGTCTTTATATGCATTACTAGCTGCCTTGCTTTCAACTTTCTGTATGTCTTAAACATTTTCGCACTGATAACAAAGATTT GGTTCTTTTTCTTAACTGTGTACAATTTCTGGTTTATATAAATCCAATGAACAAGTTCCAGGATGATATTTAAAAACTAC CAGAGTGTTGACTTCTTTTAGTTTTGCAGGCTGTGCAAAAGCTGGTTGATGAGGAGTTTCAAGGCATTGAACATCTGCGC ACATCAACGTTGCATAAAAAGATTTCTACTGCTCGCCATGATTTTATTAAACTTTCAGGTTCTGAGAACAAGCTGGATGC ATTACTTCAGGTATACTCCTATAGTTAGCCATCCTCCCTATACATGTCAACCAATGGCTGGTATTTACAGGTTGTTTTGA GATGTGGTGTAGCTCTAGTGGGACCAAGTCTATTAGGGAATTGATTGATCCTGGGGTTGA

Download Genomic Sequence

CDS sequence (LotjaGi2g1v0116900.3) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGTAAGTGGTGGTGGTCGTATTCGGCCTCAGGAGGATTCACTTAATCACCCCATTGATATGGTGGTTGGTACTCCTGG CAGGATTCTTCAACACATTGAGGAGGGAAATATGGTATATGGTGACATCAAATACTTGGTATTGGATGAGGCAGACACAA TGTTTGATAAGGGTTTTGGTCCTGATATACGCAAATTTATTGGCCCATTAAAGCATCGTTCTTCAAAGTCTGAGGGGCTA GGTTTTCAGACTGTCTTGGTCACTGCAACCATGACAAATGCTGTGCAAAAGCTGGTTGATGAGGAGTTTCAAGGCATTGA ACATCTGCGCACATCAACGTTGCATAAAAAGATTTCTACTGCTCGCCATGATTTTATTAAACTTTCAGGTTCTGAGAACA AGCTGGATGCATTACTTCAGGTTGTTTTGAGATGTGGTGTAGCTCTAGTGGGACCAAGTCTATTAGGGAATTGA

Download CDS Sequence

Protein sequence (LotjaGi2g1v0116900.3) extracted from Lotus japonicus Gifu v1.2 Proteins.

MVSGGGRIRPQEDSLNHPIDMVVGTPGRILQHIEEGNMVYGDIKYLVLDEADTMFDKGFGPDIRKFIGPLKHRSSKSEGL GFQTVLVTATMTNAVQKLVDEEFQGIEHLRTSTLHKKISTARHDFIKLSGSENKLDALLQVVLRCGVALVGPSLLGN

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
Gene3D	G3DSA:3.40.50.300 View details on G3DSA:3.40.50.300 Search for proteins/transripts with this domain View external data on G3DSA:3.40.50.300	1	106	106	9.4E-26	–
ProSiteProfiles	PS51192 View details on PS51192 Search for proteins/transripts with this domain View external data on PS51192	1	109	109	15.589	IPR014001 Show description in modal box View details on IPR014001 Search for proteins/transripts with this domain View on EBI InterPro Service
CDD	cd00268 View details on cd00268 Search for proteins/transripts with this domain View external data on cd00268	2	101	100	4.2747E-33	–
SUPERFAMILY	SSF52540 View details on SSF52540 Search for proteins/transripts with this domain View external data on SSF52540	2	101	100	9.66E-23	IPR027417 Show description in modal box View details on IPR027417 Search for proteins/transripts with this domain View on EBI InterPro Service
Pfam	PF00270 View details on PF00270 Search for proteins/transripts with this domain View external data on PF00270	3	98	96	3.6E-19	IPR011545 Show description in modal box View details on IPR011545 Search for proteins/transripts with this domain View on EBI InterPro Service
PANTHER	PTHR24031:SF694 View details on PTHR24031:SF694 Search for proteins/transripts with this domain View external data on PTHR24031:SF694	15	95	81	1.5E-22	–
PANTHER	PTHR24031 View details on PTHR24031 Search for proteins/transripts with this domain View external data on PTHR24031	15	95	81	1.5E-22	–

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0003676 View details of GO:0003676 AmiGO InterPro QuickGO	Molecular function	Nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.	Subterm of View details of GO:0097159 View details of GO:1901363
GO:0005524 View details of GO:0005524 AmiGO InterPro QuickGO	Molecular function	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.	Subterm of View details of GO:0008144 View details of GO:0032559 View details of GO:0035639

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi2g1v0116900.3, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…