Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0100900.2

Overview

Field Value
Gene ID LotjaGi3g1v0100900
Transcript ID LotjaGi3g1v0100900.2
Related isoforms 2
Lotus japonicus genome version Gifu v1.2
Description Prefoldin subunit 2 family protein; TAIR: AT3G22480.1 prefoldin 2; Swiss-Prot: sp|Q9LJ98|PFD2_ARATH Probable prefoldin subunit 2; TrEMBL-Plants: tr|A0A151SJM2|A0A151SJM2_CAJCA Putative prefoldin subunit 2; Found in the gene: LotjaGi3g1v0100900
Working Lj name n.a.

Sequence information

Genomic sequence (LjG1.1_chr3:12518873..12519355) extracted from Lotus japonicus Gifu genome v1.2.

TCTTTTCTTTACCTTACGATAGTTTGTTTTCATTTCGGTAGAATCATGGCCAGCAAGGAGCCAGTAAATGAACAAGCAGT TGCAAACACGTATGCAGCTATGAGGTCTGAACTCAACCAATATTACTCCAAAATAACTGAACTGGAAATGGAAGTTAGTG AGCACACGTTGGTTCTTAATGCCATTCAGCCACTTGACCAATCTAGGCGATGCTATCGCATGATTGGAGGGGTTCTTGTG GAGAGAACCATCAAAGAGGTCATGCCTGCTGTGCAGCGAAATAAAGAGGGACTTGAAGAGGTTGTTGCTAGACTTAATGA GGCATTGGAAAAGAAGAAAAAGGAAATTTCTGACTTTGAGGCTAAATATAAAATAAGGATAAGGAAGGCTGATGCTGAGG TGAAAGATGAGTCTGGTAGGAAGGAGGGTTCTGCTCAAGGGGTTCTTGTTGGCCCTGCGGGTGGTAGTGAATGATATGTC TAG 

CDS sequence (LotjaGi3g1v0100900.2) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCCAGCAAGGAGCCAGTAAATGAACAAGCAGTTGCAAACACGTATGCAGCTATGAGGTCTGAACTCAACCAATATTA CTCCAAAATAACTGAACTGGAAATGGAAGTTAGTGAGCACACGTTGGTTCTTAATGCCATTCAGCCACTTGACCAATCTA GGCGATGCTATCGCATGATTGGAGGGGTTCTTGTGGAGAGAACCATCAAAGAGGTCATGCCTGCTGTGCAGCGAAATAAA GAGGGACTTGAAGAGGTTGTTGCTAGACTTAATGAGGCATTGGAAAAGAAGAAAAAGGAAATTTCTGACTTTGAGGCTAA ATATAAAATAAGGATAAGGAAGGCTGATGCTGAGGTGAAAGATGAGTCTGGTAGGAAGGAGGGTTCTGCTCAAGGGGTTC TTGTTGGCCCTGCGGGTGGTAGTGAATGA 

Protein sequence (LotjaGi3g1v0100900.2) extracted from Lotus japonicus Gifu v1.2 Proteins.

MASKEPVNEQAVANTYAAMRSELNQYYSKITELEMEVSEHTLVLNAIQPLDQSRRCYRMIGGVLVERTIKEVMPAVQRNK EGLEEVVARLNEALEKKKKEISDFEAKYKIRIRKADAEVKDESGRKEGSAQGVLVGPAGGSE 

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Merging data from EBeye. Please wait…

Domains

Sorting

Prediction algorithm Identifier Start End Length E-value InterPro ID
PANTHER 3 139 137 2.4E-66
Gene3D 6 117 112 1.2E-24
SUPERFAMILY 10 111 102 1.44E-22
Pfam 10 114 105 1.3E-24
Coils 16 36 21 -
Coils 73 107 35 -
MobiDBLite 117 142 26 -

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on , while the GO metadata was last updated on .

GO term Namespace Name Definition Relationships
Biological process Protein folding The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
Cellular component Prefoldin complex A multisubunit chaperone that is capable of delivering unfolded proteins to cytosolic chaperonin, which it acts as a cofactor for. In humans, the complex is a heterohexamer of two PFD-alpha and four PFD-beta type subunits. In Saccharomyces cerevisiae, it also acts in the nucleus to regulate the rate of elongation by RNA polymerase II via a direct effect on histone dynamics.
Molecular function Unfolded protein binding Interacting selectively and non-covalently with an unfolded protein.

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0100900.2, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…