Transcript — View — Lotus Base

Your browser is unable to support new features implemented in HTML5 and CSS3 to render this site as intended. Your experience may suffer from functionality degradation but the site should remain usable. We strongly recommend the latest version of Google Chrome, OS X Safari or Mozilla Firefox. As Safari is bundled with OS X, if you are unable to upgrade to a newer version of OS X, we recommend using an open source browser. Dismiss message

LotjaGi3g1v0100900.3

Overview

Field	Value
Gene ID	LotjaGi3g1v0100900
Transcript ID	LotjaGi3g1v0100900.3
Related isoforms 2	LotjaGi3g1v0100900.1 LotjaGi3g1v0100900.2
Lotus japonicus genome version	Gifu v1.2
Description	Prefoldin subunit 2 family protein; TAIR: AT3G22480.1 prefoldin 2; Swiss-Prot: sp\|Q9LJ98\|PFD2_ARATH Probable prefoldin subunit 2; TrEMBL-Plants: tr\|A0A151SJM2\|A0A151SJM2_CAJCA Putative prefoldin subunit 2; Found in the gene: LotjaGi3g1v0100900
Working Lj name	n.a.

Genomic sequence (LjG1.1_chr3:12518882..12519409) extracted from Lotus japonicus Gifu genome v1.2.

GCTGAAAATCTAACAAAATTTGTCCTAATTTGCTTGCATTTATTCTCATTACTCTCTTTTCTTTACCTTACGATAGTTTG TTTTCATTTCGGTAGAATCATGGCCAGCAAGGAGCCAGTAAATGAACAAGCAGTTGCAAACACGTATGCAGCTATGAGGT CTGAACTCAACCAATATTACTCCAAAATAACTGAACTGGAAATGGAAGTTAGTGAGCACACGTTGGTTCTTAATGCCATT CAGCCACTTGACCAATCTAGGCGATGCTATCGCATGATTGGAGGGGTTCTTGTGGAGAGAACCATCAAAGAGGTCATGCC TGCTGTGCAGCGAAATAAAGAGGGACTTGAAGAGGTTGTTGCTAGACTTAATGAGGCATTGGAAAAGAAGAAAAAGGAAA TTTCTGACTTTGAGGCTAAATATAAAATAAGGATAAGGAAGGCTGATGCTGAGGTGAAAGATGAGTCTGGTAGGAAGGAG GGTTCTGCTCAAGGGGTTCTTGTTGGCCCTGCGGGTGGTAGTGAATGA

Download Genomic Sequence

CDS sequence (LotjaGi3g1v0100900.3) extracted from Lotus japonicus Gifu v1.2 CDS.

ATGGCCAGCAAGGAGCCAGTAAATGAACAAGCAGTTGCAAACACGTATGCAGCTATGAGGTCTGAACTCAACCAATATTA CTCCAAAATAACTGAACTGGAAATGGAAGTTAGTGAGCACACGTTGGTTCTTAATGCCATTCAGCCACTTGACCAATCTA GGCGATGCTATCGCATGATTGGAGGGGTTCTTGTGGAGAGAACCATCAAAGAGGTCATGCCTGCTGTGCAGCGAAATAAA GAGGGACTTGAAGAGGTTGTTGCTAGACTTAATGAGGCATTGGAAAAGAAGAAAAAGGAAATTTCTGACTTTGAGGCTAA ATATAAAATAAGGATAAGGAAGGCTGATGCTGAGGTGAAAGATGAGTCTGGTAGGAAGGAGGGTTCTGCTCAAGGGGTTC TTGTTGGCCCTGCGGGTGGTAGTGAATGA

Download CDS Sequence

Protein sequence (LotjaGi3g1v0100900.3) extracted from Lotus japonicus Gifu v1.2 Proteins.

MASKEPVNEQAVANTYAAMRSELNQYYSKITELEMEVSEHTLVLNAIQPLDQSRRCYRMIGGVLVERTIKEVMPAVQRNK EGLEEVVARLNEALEKKKKEISDFEAKYKIRIRKADAEVKDESGRKEGSAQGVLVGPAGGSE

Download Protein Sequence

Domain prediction

Data for domain prediction are obtained with InterProScan, and merged with InterPro data obtained from the EB-eye REST service.

Prediction algorithm	Identifier	Start	End	Length	E-value	InterPro ID
PANTHER	PTHR13303 View details on PTHR13303 Search for proteins/transripts with this domain View external data on PTHR13303	3	139	137	2.4E-66	IPR027235 Show description in modal box View details on IPR027235 Search for proteins/transripts with this domain View on EBI InterPro Service
Gene3D	G3DSA:1.10.287.370 View details on G3DSA:1.10.287.370 Search for proteins/transripts with this domain View external data on G3DSA:1.10.287.370	6	117	112	1.2E-24	IPR009053 Show description in modal box View details on IPR009053 Search for proteins/transripts with this domain View on EBI InterPro Service
SUPERFAMILY	SSF46579 View details on SSF46579 Search for proteins/transripts with this domain View external data on SSF46579	10	111	102	1.44E-22	–
Pfam	PF01920 View details on PF01920 Search for proteins/transripts with this domain View external data on PF01920	10	114	105	1.3E-24	IPR002777 Show description in modal box View details on IPR002777 Search for proteins/transripts with this domain View on EBI InterPro Service
Coils	Coil View details on Coil Search for proteins/transripts with this domain	16	36	21	-	–
Coils	Coil View details on Coil Search for proteins/transripts with this domain	73	107	35	-	–
MobiDBLite	mobidb-lite View details on mobidb-lite Search for proteins/transripts with this domain	117	142	26	-	–

Gene function (GO predictions)

GO predictions are based solely on the InterPro-to-GO mappings published by EMBL-EBI, which are in turn based on the mapping of predicted domains to the InterPro dataset. The InterPro-to-GO mapping was last updated on April 27, 2020, while the GO metadata was last updated on April 27, 2020.

GO term	Namespace	Name	Definition	Relationships
GO:0006457 View details of GO:0006457 AmiGO InterPro QuickGO	Biological process	Protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.	Subterm of View details of GO:0009987
GO:0016272 View details of GO:0016272 AmiGO InterPro QuickGO	Cellular component	Prefoldin complex	A multisubunit chaperone that is capable of delivering unfolded proteins to cytosolic chaperonin, which it acts as a cofactor for. In humans, the complex is a heterohexamer of two PFD-alpha and four PFD-beta type subunits. In Saccharomyces cerevisiae, it also acts in the nucleus to regulate the rate of elongation by RNA polymerase II via a direct effect on histone dynamics.	Subterm of View details of GO:0032991
GO:0051082 View details of GO:0051082 AmiGO InterPro QuickGO	Molecular function	Unfolded protein binding	Interacting selectively and non-covalently with an unfolded protein.	Subterm of View details of GO:0005515

Genome browser

Expression data

Expression pattern

Expression pattern of LotjaGi3g1v0100900.3, powered by ExpAt. For advanced configuration, data transformation and export options, view expression data in the ExpAt application.

Loading expression data from ljgea-geneid. Please wait…